PDB entry 3nra

View 3nra on RCSB PDB site
Description: crystal structure of an aspartate aminotransferase (yp_354942.1) from rhodobacter sphaeroides 2.4.1 at 2.15 a resolution
Deposited on 2010-06-30, released 2010-08-04
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Rhodobacter sphaeroides [TaxId:272943]
    Gene: RHOS4_34730, RSP_3437
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: aspartate aminotransferase
    Species: Rhodobacter sphaeroides [TaxId:272943]
    Gene: RHOS4_34730, RSP_3437
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, GOL, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nraA (A:)
    gmsieakfkklgtdnapgqevrqsaaglealirgapiegrpvdfshgdvdaheptpgafd
    lfsagvqsggvqayteyrgdlgirdllaprlaaftgapvdardgliitpgtqgalflava
    atvargdkvaivqpdyfanrklveffegemvpvqldyvsadetragldltgleeafkaga
    rvflfsnpnnpagvvysaeeigqiaalaarygatviadqlysrlryagasythlraeaav
    daenvvtimgpskteslsgyrlgvafgsraiiarmeklqaivslraagysqavlrgwfde
    apgwmedriarhqairdellhvlrgcegvfartpqagsylfprlpklavapaefvkilrl
    qagvvvtpgtefsphtadsvrlnfsqdheaavaaarrivtlveryra
    

    Sequence, based on observed residues (ATOM records):
    >3nraA (A:)
    sieakfkklglealirgapiegrpvdfshgdvdaheptpgafdlfsagvqsggvqaytey
    rgdlgirdllaprlaaftgapvdardgliitpgtqgalflavaatvargdkvaivqpdyf
    anrklveffegemvpvqldyvsadetragldltgleeafkagarvflfsnpnnpagvvys
    aeeigqiaalaarygatviadqlysrlryagasythlraeaavdaenvvtimgpsktesl
    sgyrlgvafgsraiiarmeklqaivslraagysqavlrgwfdeapgwmedriarhqaird
    ellhvlrgcegvfartpqagsylfprlpklavapaefvkilrlqagvvvtpgtefsphta
    dsvrlnfsqdheaavaaarrivtlveryra
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nraB (B:)
    gmsieakfkklgtdnapgqevrqsaaglealirgapiegrpvdfshgdvdaheptpgafd
    lfsagvqsggvqayteyrgdlgirdllaprlaaftgapvdardgliitpgtqgalflava
    atvargdkvaivqpdyfanrklveffegemvpvqldyvsadetragldltgleeafkaga
    rvflfsnpnnpagvvysaeeigqiaalaarygatviadqlysrlryagasythlraeaav
    daenvvtimgpskteslsgyrlgvafgsraiiarmeklqaivslraagysqavlrgwfde
    apgwmedriarhqairdellhvlrgcegvfartpqagsylfprlpklavapaefvkilrl
    qagvvvtpgtefsphtadsvrlnfsqdheaavaaarrivtlveryra
    

    Sequence, based on observed residues (ATOM records):
    >3nraB (B:)
    sieakfkklgrqsaaglealirgapiegrpvdfshgdvdaheptpgafdlfsagvqsggv
    qayteyrgdlgirdllaprlaaftgapvdardgliitpgtqgalflavaatvargdkvai
    vqpdyfanrklveffegemvpvqldyvsadetragldltgleeafkagarvflfsnpnnp
    agvvysaeeigqiaalaarygatviadqlysrlryagasythlraeaavdaenvvtimgp
    skteslsgyrlgvafgsraiiarmeklqaivslraagysqavlrgwfdeapgwmedriar
    hqairdellhvlrgcegvfartpqagsylfprlpklavapaefvkilrlqagvvvtpgte
    fsphtadsvrlnfsqdheaavaaarrivtlveryra