PDB entry 3nr9

View 3nr9 on RCSB PDB site
Description: structure of human cdc2-like kinase 2 (clk2)
Deposited on 2010-06-30, released 2010-08-25
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity protein kinase CLK2
    Species: Homo sapiens [TaxId:9606]
    Gene: CLK2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Dual specificity protein kinase CLK2
    Species: Homo sapiens [TaxId:9606]
    Gene: CLK2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Dual specificity protein kinase CLK2
    Species: Homo sapiens [TaxId:9606]
    Gene: CLK2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NR9, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nr9A (A:)
    smrssshssrraksveddaeghliyhvgdwlqeryeivstlgegtfgrvvqcvdhrrgga
    rvalkiiknvekykeaarleinvlekinekdpdnknlcvqmfdwfdyhghmcisfellgl
    stfdflkdnnylpypihqvrhmafqlcqavkflhdnklthtdlkpenilfvnsdyeltyn
    lekkrdersvkstavrvvdfgsatfdhehhstivstrhyrapevilelgwsqpcdvwsig
    ciifeyyvgftlfqthdnrehlammerilgpipsrmirktrkqkyfyrgrldwdentsag
    ryvrenckplrryltseaeehhqlfdliesmleyepakrltlgealqhpffarlraeppn
    klwdssrd
    

    Sequence, based on observed residues (ATOM records):
    >3nr9A (A:)
    srraksveddaeghliyhvgdwlqeryeivstlgegtfgrvvqcvdhrrggarvalkiik
    nvekykeaarleinvlekinekdpdnknlcvqmfdwfdyhghmcisfellglstfdflkd
    nnylpypihqvrhmafqlcqavkflhdnklthtdlkpenilfvnsdyeltdersvkstav
    rvvdfgsatfdhehhstivstrhyrapevilelgwsqpcdvwsigciifeyyvgftlfqt
    hdnrehlammerilgpipsrmirktrkqkyfyrgrldwdentsagryvrenckplrrylt
    seaeehhqlfdliesmleyepakrltlgealqhpffarlra
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nr9B (B:)
    smrssshssrraksveddaeghliyhvgdwlqeryeivstlgegtfgrvvqcvdhrrgga
    rvalkiiknvekykeaarleinvlekinekdpdnknlcvqmfdwfdyhghmcisfellgl
    stfdflkdnnylpypihqvrhmafqlcqavkflhdnklthtdlkpenilfvnsdyeltyn
    lekkrdersvkstavrvvdfgsatfdhehhstivstrhyrapevilelgwsqpcdvwsig
    ciifeyyvgftlfqthdnrehlammerilgpipsrmirktrkqkyfyrgrldwdentsag
    ryvrenckplrryltseaeehhqlfdliesmleyepakrltlgealqhpffarlraeppn
    klwdssrd
    

    Sequence, based on observed residues (ATOM records):
    >3nr9B (B:)
    ssrraksveddaeghliyhvgdwlqeryeivstlgegtfgrvvqcvdhrrggarvalkii
    knvekykeaarleinvlekinekdpdnknlcvqmfdwfdyhghmcisfellglstfdflk
    dnnylpypihqvrhmafqlcqavkflhdnklthtdlkpenilfvnsdyeltynlekkrde
    rsvkstavrvvdfgsatfdhehhstivstrhyrapevilelgwsqpcdvwsigciifeyy
    vgftlfqthdnrehlammerilgpipsrmirktrkqkyfyrgrldwdentsagryvrenc
    kplrryltseaeehhqlfdliesmleyepakrltlgealqhpffarl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nr9C (C:)
    smrssshssrraksveddaeghliyhvgdwlqeryeivstlgegtfgrvvqcvdhrrgga
    rvalkiiknvekykeaarleinvlekinekdpdnknlcvqmfdwfdyhghmcisfellgl
    stfdflkdnnylpypihqvrhmafqlcqavkflhdnklthtdlkpenilfvnsdyeltyn
    lekkrdersvkstavrvvdfgsatfdhehhstivstrhyrapevilelgwsqpcdvwsig
    ciifeyyvgftlfqthdnrehlammerilgpipsrmirktrkqkyfyrgrldwdentsag
    ryvrenckplrryltseaeehhqlfdliesmleyepakrltlgealqhpffarlraeppn
    klwdssrd
    

    Sequence, based on observed residues (ATOM records):
    >3nr9C (C:)
    srraksveddaeghliyhvgdwlqeryeivstlgegtfgrvvqcvdhrrggarvalkiik
    nvekykeaarleinvlekinekdpdnknlcvqmfdwfdyhghmcisfellglstfdflkd
    nnylpypihqvrhmafqlcqavkflhdnklthtdlkpenilfvnsdyeltynlekkrder
    svkstavrvvdfgsatfdhehhstivstrhyrapevilelgwsqpcdvwsigciifeyyv
    gftlfqthdnrehlammerilgpipsrmirktrkqkyfyrgrldwdentsagryvrenck
    plrryltseaeehhqlfdliesmleyepakrltlgealqhpffarlr