PDB entry 3nr6

View 3nr6 on RCSB PDB site
Description: crystal structure of xenotropic murine leukemia virus-related virus (xmrv) protease
Deposited on 2010-06-30, released 2011-02-02
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease p14
    Species: Xenotropic MuLV-related virus VP62 [TaxId:373193]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protease p14
    Species: Xenotropic MuLV-related virus VP62 [TaxId:373193]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
  • Heterogens: K, PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nr6A (A:)
    mhhhhhhtlgdqggqgqepppepritlkvggqpvtflvdtgaqhsvltqnpgplsdksaw
    vqgatggkryrwttdrkvhlatgkvthsflhvpdcpypllgrdlltklkaqihfegsgaq
    vvgpmgqplqvl
    

    Sequence, based on observed residues (ATOM records):
    >3nr6A (A:)
    tlgdqggqgqepppepritlkvggqpvtflvdtgaqhsvltqnpgplsdksawvqgkryr
    wttdrkvhlatgkvthsflhvpdcpypllgrdlltklkaqihfegsgaqvvgpmgqplqv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nr6B (B:)
    mhhhhhhtlgdqggqgqepppepritlkvggqpvtflvdtgaqhsvltqnpgplsdksaw
    vqgatggkryrwttdrkvhlatgkvthsflhvpdcpypllgrdlltklkaqihfegsgaq
    vvgpmgqplqvl
    

    Sequence, based on observed residues (ATOM records):
    >3nr6B (B:)
    tlgdqpppepritlkvggqpvtflvdtgaqhsvltqnpgplsdksawvgkryrwttdrkv
    hlatgkvthsflhvpdcpypllgrdlltklkaqihfegsgaqvvgpmgqplqvl