PDB entry 3nr5

View 3nr5 on RCSB PDB site
Description: Crystal structure of human Maf1
Deposited on 2010-06-30, released 2010-10-13
The last revision was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.19
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Repressor of RNA polymerase III transcription MAF1 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: MAF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H063 (6-163)
      • expression tag (5)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nr5A (A:)
    hhhhhhmkllenssfeainsqltvetgdahiigriesysckplsdkcsrktlfyliatln
    esfrpdydfstarshefsrepslswvvnavncslfsavredfkdlkpqlwnavdeeicla
    ecdiysynpdldsdpfgedgslwsfnyffynkrlkrivffscrs
    

    Sequence, based on observed residues (ATOM records):
    >3nr5A (A:)
    hmkllenssfeainsqltvedahiigriesysckplsdkcsrktlfyliatlnesfrpdy
    dfstarshefsrepslswvvnavncslfsavredfkdlkpqlwnavdeeiclaecdiysy
    npdldsdpfgedgslwsfnyffynkrlkrivffscrs