PDB entry 3nr3

View 3nr3 on RCSB PDB site
Description: Crystal Structure of Human Peripheral Myelin Protein 2
Class: transport protein
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, Transport, TRANSPORT PROTEIN
Deposited on 2010-06-30, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PMP2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: hCG_21300, PMP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FHL4 (23-152)
      • expression tag (18-22)
    Domains in SCOPe 2.07: d3nr3a1, d3nr3a2
  • Heterogens: PLM, SO4, GOL, CIT, EPE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nr3A (A:)
    mhhhhhhssgvdlgtenlyfqsmnkflgtwklvssenfddymkalgvglatrklgnlakp
    tviiskkgdiitirtestfknteisfklgqefeettadnrktksivtlqrgslnqvqrwd
    gkettikrklvngkmvaeckmkgvvctriyekv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nr3A (A:)
    yfqsmnkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtest
    fknteisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvae
    ckmkgvvctriyekv