PDB entry 3nr1

View 3nr1 on RCSB PDB site
Description: a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in starvation responses
Deposited on 2010-06-30, released 2010-09-08
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HD domain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: HDDC3
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: HD domain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: HDDC3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nr1A (A:)
    gseaaqlleaadfaarkhrqqrrkdpegtpyinhpigvariltheagitdivvlqaallh
    dtvedtdttldevelhfgaqvrrlveevtddktlpklerkrlqveqaphsspgaklvkla
    dklynlrdlnrctpegwsehrvqeyfewaaqvvkglqgtnrqleealkhlfkqrglti
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3nr1B (B:)
    gseaaqlleaadfaarkhrqqrrkdpegtpyinhpigvariltheagitdivvlqaallh
    dtvedtdttldevelhfgaqvrrlveevtddktlpklerkrlqveqaphsspgaklvkla
    dklynlrdlnrctpegwsehrvqeyfewaaqvvkglqgtnrqleealkhlfkqrglti