PDB entry 3nr0

View 3nr0 on RCSB PDB site
Description: Optimization of the in silico designed Kemp eliminase KE70 by computational design and directed evolution R6 6/10A
Deposited on 2010-06-30, released 2011-02-09
The last revision was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribose phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NR0
  • Chain 'B':
    Compound: deoxyribose phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NR0
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nr0A (A:)
    matlkasslralklmhlatsandddtdenvialchqaktpvgntdaifiyprfipiarkt
    lkeqgtpeirictstnfphgnddidialaetraaiaygadsvavvfpyralmagneqvgf
    dlvkackeacaaanvllaviietgelkdealirkaseisikagadnivtstgkvavgatp
    esarimmevirdmgvektvgfipvggvrtaedaqkylaiadelfgadwadarhyafgasa
    sllasllkalghgdgksassygslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nr0A (A:)
    atlkasslralklmhlattdenvialchqaktpvgntdaifiyprfipiarktlkeqgtp
    eirictstnfphgnddidialaetraaiaygadsvavvfpyralmagneqvgfdlvkack
    eacaaanvllaviietgelkdealirkaseisikagadnivtstgkvavgatpesarimm
    evirdmgvektvgfipvggvrtaedaqkylaiadelfgadwadarhyafgasasllasll
    kalgh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nr0B (B:)
    matlkasslralklmhlatsandddtdenvialchqaktpvgntdaifiyprfipiarkt
    lkeqgtpeirictstnfphgnddidialaetraaiaygadsvavvfpyralmagneqvgf
    dlvkackeacaaanvllaviietgelkdealirkaseisikagadnivtstgkvavgatp
    esarimmevirdmgvektvgfipvggvrtaedaqkylaiadelfgadwadarhyafgasa
    sllasllkalghgdgksassygslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nr0B (B:)
    atlkasslralklmhlattdenvialchqaktpvgntdaifiyprfipiarktlkeqgtp
    eirictstnfphgnddidialaetraaiaygadsvavvfpyralmagneqvgfdlvkack
    eacaaanvllaviietgelkdealirkaseisikagadnivtstgkvavgatpesarimm
    evirdmgvektvgfipvggvrtaedaqkylaiadelfgadwadarhyafgasasllasll
    kalgh