PDB entry 3nqw

View 3nqw on RCSB PDB site
Description: a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in starvation responses
Deposited on 2010-06-30, released 2010-09-08
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cg11900
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG11900, Dmel_CG11900
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: cg11900
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG11900, Dmel_CG11900
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nqwA (A:)
    matypsakfmeclqyaafkhrqqrrkdpqetpyvnhvinvstilsveacitdegvlmaal
    lhdvvedtdasfedveklfgpdvcglvrevtddkslekqerkrlqienaaksscraklik
    ladkldnlrdlqvntptgwtqerrdqyfvwakkvvdnlrgtnanlelkldeifrqrgll
    

    Sequence, based on observed residues (ATOM records):
    >3nqwA (A:)
    atypsakfmeclqyaafkhrqqrrkdpqetpyvnhvinvstilsveacitdegvlmaall
    hdvvedtdasfedveklfgpdvcglvrevtddkslekqerkrlqienaaksscraklikl
    adkldnlrdlqvntptgwtqerrdqyfvwakkvvdnlrgtnanlelkldeifrqrgll
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nqwB (B:)
    matypsakfmeclqyaafkhrqqrrkdpqetpyvnhvinvstilsveacitdegvlmaal
    lhdvvedtdasfedveklfgpdvcglvrevtddkslekqerkrlqienaaksscraklik
    ladkldnlrdlqvntptgwtqerrdqyfvwakkvvdnlrgtnanlelkldeifrqrgll
    

    Sequence, based on observed residues (ATOM records):
    >3nqwB (B:)
    atypsakfmeclqyaafkhrqqrrkdpqetpyvnhvinvstilsveacitdegvlmaall
    hdvvedtdasfedveklfgpdvcglvrevtddkslekqerkrlqienaaksscraklikl
    adkldnlrdlqvntptgwtqerrdqyfvwakkvvdnlrgtnanlelkldeifrqrgll