PDB entry 3nqv

View 3nqv on RCSB PDB site
Description: Optimization of the in silico designed Kemp eliminase KE70 by computational design and directed evolution R5 7/4A
Deposited on 2010-06-29, released 2011-02-09
The last revision was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.206
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribose phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NQV
  • Heterogens: BEN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nqvA (A:)
    matdlkasslralklmhlatandddtdenvialchqaktpvgntdaifiyprfipiarkt
    lkeqgtpeirictstnfphgnddidialaetraaiaygadsvavvfpyralmagneqvgf
    dlvkackeacaaanvllaviietgelkdealirkaseisikagadnivtstpgkvaegat
    pesarimmevirdmgvektvgfipvggvrtaedaqkylaiadelfgadwadsrhyafgas
    ssllasllkalghgdgksassygslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nqvA (A:)
    lkasslralklmhlatddtdenvialchqaktpvgntdaifiyprfipiarktlkeqgtp
    eirictstnfphgnddidialaetraaiaygadsvavvfpyralmagneqvgfdlvkack
    eacaaanvllaviietgelkdealirkaseisikagadnivtstpgkvaegatpesarim
    mevirdmgvektvgfipvggvrtaedaqkylaiadelfgadwadsrhyafgasssllasl
    lkalgh