PDB entry 3nqs

View 3nqs on RCSB PDB site
Description: Crystal Structure of Inducible Nitric Oxide Synthase with N-Nitrosated-pterin
Class: oxidoreductase
Keywords: Nitrosylation, Nitrosation, N-NO-pterin, OXIDOREDUCTASE
Deposited on 2010-06-29, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Gene: Inosl, Nos2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nqsa_
  • Chain 'B':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Gene: Inosl, Nos2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nqsb_
  • Heterogens: HEM, H4B, NO, AT2, GOL, EDO, SO4, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nqsA (A:)
    ldklhvtstrpqyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprd
    kptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatk
    mawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrs
    dgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqa
    dgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfng
    wymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnv
    timdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyy
    qiepwkthiwqne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nqsA (A:)
    qyvriknwgsgeilhdtlhhkatclgsimnpksltrgprdkptpleellphaiefinqyy
    gsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlqv
    fdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagyq
    mpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevtm
    ehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqryni
    leevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqney
    rarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nqsB (B:)
    ldklhvtstrpqyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprd
    kptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatk
    mawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrs
    dgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqa
    dgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfng
    wymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnv
    timdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyy
    qiepwkthiwqne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nqsB (B:)
    qyvriknwgsgeilhdtlhhkatclgsimnpksltrgprdkptpleellphaiefinqyy
    gsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlqv
    fdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagyq
    mpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevtm
    ehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqryni
    leevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqney
    rarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwqn