PDB entry 3nqp

View 3nqp on RCSB PDB site
Description: crystal structure of a susd superfamily protein (bf1802) from bacteroides fragilis nctc 9343 at 1.90 a resolution
Deposited on 2010-06-29, released 2010-10-13
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SusD superfamily protein
    Species: Bacteroides fragilis NCTC 9343 [TaxId:272559]
    Gene: BF1802
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: SusD superfamily protein
    Species: Bacteroides fragilis NCTC 9343 [TaxId:272559]
    Gene: BF1802
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, EDO, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nqpA (A:)
    gdkldlspidyygsgsywkteaqatayidgihkhlrdaawqhtitfgelrggrfitgass
    dgmgvsngdiilqnfdethtgvskfgdlfgritnlnlfiarvtdatylsdemknfylgev
    yglrafyyfdlyriyggvplrltadvvegvidpnklymarstpkevmtqiksdlnksmey
    fgnmndfdpykrgkkvywskaateclmgevylwtskvttgddvanpadltiakthlesvl
    nnynlkmlddfsqvfnaknkandeiifairflegeatnsngtftynvgtgstknryqang
    evfgdaldiqntgnqtyeynkavyqnfddadtrkeatfiasynkdgktgelslygthvrk
    nigyvnaqgarvycgdyifyrlpwvyltlaeianmegdnaavakyinlvrkraygnawde
    tlyaypetadfttnelailhekdkefiqegqrwwdlrrmtltkggtplvfckegsllgda
    pilnksteahkllwpiektmlnkdpaleqtpgyk
    

    Sequence, based on observed residues (ATOM records):
    >3nqpA (A:)
    ywkteaqatayidgihkhlrdaawqhtitfgelrggrfitgassdgmgvsngdiilqnfd
    ethtgvskfgdlfgritnlnlfiarvtdatylsdemknfylgevyglrafyyfdlyriyg
    gvplrltlymarstpkevmtqiksdlnksmeyfgnmndfdpykrgkkvywskaateclmg
    evylwtskvttgddvanpadltiakthlesvlnnynlkmlddfsqvfnaknkandeiifa
    irflegeatnsngtftynvgtgstknryqangevfgdaldiqntgnqtyeynkavyqnfd
    dadtrkeatfiasynkdgktgelslygthvrknigyvnaqgarvycgdyifyrlpwvylt
    laeianmegdnaavakyinlvrkraygnawdetlyaypetadfttnelailhekdkefiq
    egqrwwdlrrmtltkggtplvfckegsllgdapilnksteahkllwpiektmlnkdpale
    qtpgyk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nqpB (B:)
    gdkldlspidyygsgsywkteaqatayidgihkhlrdaawqhtitfgelrggrfitgass
    dgmgvsngdiilqnfdethtgvskfgdlfgritnlnlfiarvtdatylsdemknfylgev
    yglrafyyfdlyriyggvplrltadvvegvidpnklymarstpkevmtqiksdlnksmey
    fgnmndfdpykrgkkvywskaateclmgevylwtskvttgddvanpadltiakthlesvl
    nnynlkmlddfsqvfnaknkandeiifairflegeatnsngtftynvgtgstknryqang
    evfgdaldiqntgnqtyeynkavyqnfddadtrkeatfiasynkdgktgelslygthvrk
    nigyvnaqgarvycgdyifyrlpwvyltlaeianmegdnaavakyinlvrkraygnawde
    tlyaypetadfttnelailhekdkefiqegqrwwdlrrmtltkggtplvfckegsllgda
    pilnksteahkllwpiektmlnkdpaleqtpgyk
    

    Sequence, based on observed residues (ATOM records):
    >3nqpB (B:)
    ywkteaqatayidgihkhlrdaawqhtitfgelrggrfitgassdgmgvsngdiilqnfd
    ethtgvskfgdlfgritnlnlfiarvtdatylsdemknfylgevyglrafyyfdlyriyg
    gvplrltklymarstpkevmtqiksdlnksmeyfgnmndfdpykrgkkvywskaateclm
    gevylwtskvttgddvanpadltiakthlesvlnnynlkmlddfsqvfnaknkandeiif
    airflegeatnsngtftynvgtgstknryqangevfgdaldiqntgnqtyeynkavyqnf
    ddadtrkeatfiasynkdgktgelslygthvrknigyvnaqgarvycgdyifyrlpwvyl
    tlaeianmegdnaavakyinlvrkraygnawdetlyaypetadfttnelailhekdkefi
    qegqrwwdlrrmtltkggtplvfckegsllgdapilnksteahkllwpiektmlnkdpal
    eqtpgyk