PDB entry 3nqo

View 3nqo on RCSB PDB site
Description: crystal structure of a marr family transcriptional regulator (cd1569) from clostridium difficile 630 at 2.20 a resolution
Deposited on 2010-06-29, released 2010-07-21
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MarR-family transcriptional regulator
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD1569
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: MarR-family transcriptional regulator
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD1569
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, PG4, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nqoA (A:)
    gmdysnelkelflmnqtyatlftltnkiqiegdkyfgiltsrqymtilsilhlpeeettl
    nniarkmgtskqninrlvanlekngyvdvipsphdkrainvkvtdlgkkvmvtcsrtgin
    fmadvfheftkdeletlwsllkkmyrfngeeqdgfeedanfmeyeeidkiksealeefak
    rrnrvnknd
    

    Sequence, based on observed residues (ATOM records):
    >3nqoA (A:)
    dysnelkelflmnqtyatlftltnkiqiegdkyfgiltsrqymtilsilhlpeeettlnn
    iarkmgtskqninrlvanlekngyvdvipsphdkrainvkvtdlgkkvmvtcsrtginfm
    advfheftkdeletlwsllkkmyrfngeeqdgfeedaneidkiksealeefakrrnrvnk
    nd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nqoB (B:)
    gmdysnelkelflmnqtyatlftltnkiqiegdkyfgiltsrqymtilsilhlpeeettl
    nniarkmgtskqninrlvanlekngyvdvipsphdkrainvkvtdlgkkvmvtcsrtgin
    fmadvfheftkdeletlwsllkkmyrfngeeqdgfeedanfmeyeeidkiksealeefak
    rrnrvnknd
    

    Sequence, based on observed residues (ATOM records):
    >3nqoB (B:)
    ysnelkelflmnqtyatlftltnkiqiegdkyfgiltsrqymtilsilhlpeeettlnni
    arkmgtskqninrlvanlekngyvdvipsphdkrainvkvtdlgkkvmvtcsrtginfma
    dvfheftkdeletlwsllkkmyrfngeeqdgfeeidkiksealeefakrrnrvnknd