PDB entry 3nqn

View 3nqn on RCSB PDB site
Description: crystal structure of a protein with unknown function. (dr_2006) from deinococcus radiodurans at 1.88 a resolution
Deposited on 2010-06-29, released 2010-08-18
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_2006
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR_2006
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RSW5 (1-End)
      • leader sequence (0)
  • Heterogens: CA, MRD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nqnA (A:)
    gmilsaeqsftlrhphgqaaalafvrepaaalagvrflrgldsdgeqvwgellvtvpllg
    evdlpfrseivrtpqgaelrpltltgerawvavsgqataaeggemafafqfqahlatpea
    egwggaafekmvqaaagrtlervakalpeglaaglppa
    

    Sequence, based on observed residues (ATOM records):
    >3nqnA (A:)
    lsaeqsftlrhphgqaaalafvrepaaalagvrflrgldsdgeqvwgellvtvpllgevd
    lpfrseivrtpqgaelrpltltgerawvavsgqataaeggemafafqfqahlaegwggaa
    fekmvqaaagrtlervakalpeglaaglppa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nqnB (B:)
    gmilsaeqsftlrhphgqaaalafvrepaaalagvrflrgldsdgeqvwgellvtvpllg
    evdlpfrseivrtpqgaelrpltltgerawvavsgqataaeggemafafqfqahlatpea
    egwggaafekmvqaaagrtlervakalpeglaaglppa
    

    Sequence, based on observed residues (ATOM records):
    >3nqnB (B:)
    gmilsaeqsftlrhphgqaaalafvrepaaalagvrflrgldsdgeqvwgellvtvpllg
    evdlpfrseivrtpqgaelrpltltgerawvavsgqataaeggemafafqfqahlatgaa
    fekmvqaaagrtlervakalpeglaaglpp