PDB entry 3nqk

View 3nqk on RCSB PDB site
Description: crystal structure of a structural genomics, unknown function (bacova_03322) from bacteroides ovatus at 2.61 a resolution
Deposited on 2010-06-29, released 2010-08-04
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Bacteroides ovatus [TaxId:411476]
    Gene: BACOVA_03322
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nqkA (A:)
    gnewedeqyeqyvsfkapiasgsdgvttiyvrykdngkvtyqlpiivsgstvnsqdrdih
    iavdkdtlktlnierfslyrpelwytemeedkyefpetvhipagscvellnidfnlqdid
    mlekwvlpltivddgsyayqshprknyakallkvvpfnnysgsytassmkvytyingkpd
    tnarttdkrtgyvvdnnsiffyaglinedmdkdmrkkykinvhfkedgtldmkqddpsne
    mefeligtptysstsvmdatrpylerryvqimfeydfqdftyggsgtevipikyrvagsm
    tllrnintqipdedqqiew
    

    Sequence, based on observed residues (ATOM records):
    >3nqkA (A:)
    qyvsfkapiasgsdgvttiyvrykdngkvtyqlpiivsgstvnsqdrdihiavdkdtlkt
    lnierfslyrpelwytemeedkyefpetvhipagscvellnidfnlqdidmlekwvlplt
    ivddgsyayqknyakallkvvpfnnysgsytassmkvytyingkpdtnarttdkrtgyvv
    dnnsiffyaglinedmdkdmrkkykinvhfkedgtldmkqddpsnemefeligtptysst
    svmdatrpylerryvqimfeydfqdftyggsgtevipikyrvagsmtllrnintqipded
    qqiew