PDB entry 3nqj

View 3nqj on RCSB PDB site
Description: Crystal structure of (CENP-A/H4)2 heterotetramer
Class: DNA binding protein
Keywords: alpha helix, histone fold, centromere, DNA BINDING PROTEIN
Deposited on 2010-06-29, released 2010-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3-like centromeric protein A
    Species: Homo sapiens [TaxId:9606]
    Gene: CENPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49450 (1-End)
      • insertion (0)
    Domains in SCOPe 2.07: d3nqja_
  • Chain 'B':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H4A, H4/A, H4FA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nqjb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nqjA (A:)
    mllirklpfsrlareicvkftrgvdfnwqaqallalqeaaeaflvhlfedaylltlhagr
    vtlfpkdvqlarrirgleeglg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nqjA (A:)
    mllirklpfsrlareicvkftrgvdfnwqaqallalqeaaeaflvhlfedaylltlhagr
    vtlfpkdvqlarrirg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nqjB (B:)
    mkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
    ktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nqjB (B:)
    dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
    mdvvyalkr