PDB entry 3nqi

View 3nqi on RCSB PDB site
Description: crystal structure of a putative lipoprotein (bf3042) from bacteroides fragilis nctc 9343 at 1.87 a resolution
Deposited on 2010-06-29, released 2010-08-18
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative lipoprotein
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF3042
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative lipoprotein
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF3042
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Putative lipoprotein
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF3042
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Putative lipoprotein
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF3042
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CD, CL, PEG, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nqiA (A:)
    gmdsgesgpqqwagvvkvndrmgyvtftdaagteliptntipvtlnarmayiycqvdegq
    dlstnpksikitlladptgidataittpkvgesgdvttnapvgslsfvsgystvapfqfs
    entivlpvlyrvknvtttediknelakhtftlvcytddiksgdtilklylrykvedepaa
    iaeratrtssfkayeisqilreytlksgqtkpakitivaqqneynnkledtstiekvyei
    eyktae
    

    Sequence, based on observed residues (ATOM records):
    >3nqiA (A:)
    pqqwagvvkvndrmgyvtftdaagteliptntipvtlnarmayiycqvdegqksikitll
    adptgidataittpkvgesgdvttnapvgslsfvsgystvapfqfsentivlpvlyrvkn
    vtttediknelakhtftlvcytddiksgdtilklylrykvedepaaiaeratrtssfkay
    eisqilreytlksgqtkpakitivaqqneynnkledtstiekvyeieyktae
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nqiB (B:)
    gmdsgesgpqqwagvvkvndrmgyvtftdaagteliptntipvtlnarmayiycqvdegq
    dlstnpksikitlladptgidataittpkvgesgdvttnapvgslsfvsgystvapfqfs
    entivlpvlyrvknvtttediknelakhtftlvcytddiksgdtilklylrykvedepaa
    iaeratrtssfkayeisqilreytlksgqtkpakitivaqqneynnkledtstiekvyei
    eyktae
    

    Sequence, based on observed residues (ATOM records):
    >3nqiB (B:)
    qqwagvvkvndrmgyvtftdaagteliptntipvtlnarmayiycqvdegqpksikitll
    adptgidataittpkvgesgdvttnapvgslsfvystvapfqfsentivlpvlyrvknvt
    ttediknelakhtftlvcytddiksgdtilklylrykvedepaaiaeratrtssfkayei
    sqilreytlksgqtkpakitivaqqneynnkledtstiekvyeieyktae
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nqiC (C:)
    gmdsgesgpqqwagvvkvndrmgyvtftdaagteliptntipvtlnarmayiycqvdegq
    dlstnpksikitlladptgidataittpkvgesgdvttnapvgslsfvsgystvapfqfs
    entivlpvlyrvknvtttediknelakhtftlvcytddiksgdtilklylrykvedepaa
    iaeratrtssfkayeisqilreytlksgqtkpakitivaqqneynnkledtstiekvyei
    eyktae
    

    Sequence, based on observed residues (ATOM records):
    >3nqiC (C:)
    pqqwagvvkvndrmgyvtftdaagteliptntipvtlnarmayiycqvdeksikitllad
    ptgidataittpkvgesgdvttnapvgslsfvsgystvapfqfsentivlpvlyrvknvt
    ttediknelakhtftlvcytddiksgdtilklylrykvedepaaiaeratrtssfkayei
    sqilreytlksgqtkpakitivaqqneynnkledtstiekvyeieyktae
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nqiD (D:)
    gmdsgesgpqqwagvvkvndrmgyvtftdaagteliptntipvtlnarmayiycqvdegq
    dlstnpksikitlladptgidataittpkvgesgdvttnapvgslsfvsgystvapfqfs
    entivlpvlyrvknvtttediknelakhtftlvcytddiksgdtilklylrykvedepaa
    iaeratrtssfkayeisqilreytlksgqtkpakitivaqqneynnkledtstiekvyei
    eyktae
    

    Sequence, based on observed residues (ATOM records):
    >3nqiD (D:)
    qqwagvvkvndrmgyvtftdaagteliptntipvtlnarmayiycqvdepksikitllad
    ptgidataittpkvgesgdvttnapvgslsfvsgystvapfqfsentivlpvlyrvknvt
    ttediknelakhtftlvcytddiksgdtilklylrykvedepaaiaeratrtssfkayei
    sqilreytlksgqtkpakitivaqqneynnkledtstiekvyeieyktae