PDB entry 3nqh

View 3nqh on RCSB PDB site
Description: crystal structure of a glycosyl hydrolase (bt_2959) from bacteroides thetaiotaomicron vpi-5482 at 2.11 a resolution
Deposited on 2010-06-29, released 2010-07-28
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycosyl hydrolase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: BT_2959
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nqhA (A:)
    grktekvvnngipwfddrgeivnahgaciveengryylfgeyksdksnafpgfscyssdd
    lvnwkfervvlpmqssgilgpdrvgervkvmkcpstgeyvmymhaddmnykdphigyatc
    stiageyklhgpllyegkpirrwdmgtyqdtdgtgylllhggivyrlskdyrtaeekvvs
    gvggshgespamfkkdgtyfflfsnltswekndnfyftapsvkgpwtrqglfapegslty
    nsqttfvfplkcgedtipmfmgdrwsyphqasaatyvwmpmqvdgtklsipeywpswdvd
    klkpvnplrkgktvdlkkitfskeadwkveegrissnvkgstlsipftgscvavmgetnc
    hsgyarmnildkkgekiysslvdfyskandhatrfktpqlaegeytlvievtgisptwtd
    ktkriygsddcfvtitdivkl
    

    Sequence, based on observed residues (ATOM records):
    >3nqhA (A:)
    ktekvvnngipwfddrgeivnahgaciveengryylfgeyksdksnafpgfscyssddlv
    nwkfervvlpmqssgilgpdrvgervkvmkcpstgeyvmymhaddmnykdphigyatcst
    iageyklhgpllyegkpirrwdmgtyqdtdgtgylllhggivyrlskdyrtaeekvvsgv
    ggshgespamfkkdgtyfflfsnltswekndnfyftapsvkgpwtrqglfapegsltyns
    qttfvfplkcgedtipmfmgdrwsyphqasaatyvwmpmqvdgtklsipeywpswdvdkl
    kpvnplrkgktvdlkkitfskeadwkveegrissnvkgstlsipftgscvavmgetnchs
    gyarmnildkkgekiysslvdfyskandhatrfktpqlaegeytlvievtgisptwtdkt
    kriygsddcfvtitdivkl