PDB entry 3nqb

View 3nqb on RCSB PDB site
Description: Crystal Structure of Adenine Deaminase from Agrobacterium tumefaciens (str. C 58)
Deposited on 2010-06-29, released 2010-07-28
The last revision was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.175
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenine deaminase 2
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: ade2, adeC, Atu4426, AGR_L_883
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Adenine deaminase 2
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: ade2, adeC, Atu4426, AGR_L_883
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nqbA (A:)
    mslmtaqirlaepadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigiv
    galiasvhepasrrdaaqvidaggayvspglidthmhiessmitpaayaaavvargvtti
    vwdphefgnvhgvdgvrwaakaienlplraillapscvpsapglerggadfdaailadll
    swpeiggiaeimnmrgvierdprmsgivqaglaaeklvcgharglknadlnafmaagvss
    dhelvsgedlmaklragltielrgshdhllpefvaalntlghlpqtvtlctddvfpddll
    qggglddvvrrlvryglkpewalraatlnaaqrlgrsdlgliaagrradivvfedlngfs
    arhvlasgravaeggrmlvdiptcdttvlkgsmklplrmandflvksqgakvrlatidrp
    rftqwgeteadvkdgfvvppegatmisvthrhgmaepttktgfltgwgrwngafattvsh
    dshnltvfggnagdmalaanavigtgggmavasegkvtailplplsglvsdapleevara
    fedlreavgkvvewqppylvfkacfgatlacnigphqtdmgiadvltgkvmespvievlg
    eghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nqbA (A:)
    epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa
    srrdaaqvidaggayvspglidthmhiessmitpaayaaavvargvttivwdphefgnvh
    gvdgvrwaakaienlplraillapscvpsapglerggadfdaailadllswpeiggiaei
    mnmrgvierdprmsgivqaglaaeklvcgharglknadlnafmaagvssdhelvsgedlm
    aklragltielrgshdhllpefvaalntlghlpqtvtlctddvfpddllqggglddvvrr
    lvryglkpewalraatlnaaqrlgrsdlgliaagrradivvfedlngfsarhvlasgrav
    aeggrmlvdiptcdttvlkgsmklplrmandflvksqgakvrlatidrprftqwgetead
    vkdgfvvppegatmisvthrhgmaepttktgfltgwgrwngafattvshdshnltvfggn
    agdmalaanavigtgggmavasegkvtailplplsglvsdapleevarafedlreavgkv
    vewqppylvfkacfgatlacnigphqtdmgiadvltgkvmespviev
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nqbB (B:)
    mslmtaqirlaepadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigiv
    galiasvhepasrrdaaqvidaggayvspglidthmhiessmitpaayaaavvargvtti
    vwdphefgnvhgvdgvrwaakaienlplraillapscvpsapglerggadfdaailadll
    swpeiggiaeimnmrgvierdprmsgivqaglaaeklvcgharglknadlnafmaagvss
    dhelvsgedlmaklragltielrgshdhllpefvaalntlghlpqtvtlctddvfpddll
    qggglddvvrrlvryglkpewalraatlnaaqrlgrsdlgliaagrradivvfedlngfs
    arhvlasgravaeggrmlvdiptcdttvlkgsmklplrmandflvksqgakvrlatidrp
    rftqwgeteadvkdgfvvppegatmisvthrhgmaepttktgfltgwgrwngafattvsh
    dshnltvfggnagdmalaanavigtgggmavasegkvtailplplsglvsdapleevara
    fedlreavgkvvewqppylvfkacfgatlacnigphqtdmgiadvltgkvmespvievlg
    eghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nqbB (B:)
    aepadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhep
    asrrdaaqvidaggayvspglidthmhiessmitpaayaaavvargvttivwdphefgnv
    hgvdgvrwaakaienlplraillapscvpsapglerggadfdaailadllswpeiggiae
    imnmrgvierdprmsgivqaglaaeklvcgharglknadlnafmaagvssdhelvsgedl
    maklragltielrgshdhllpefvaalntlghlpqtvtlctddvfpddllqggglddvvr
    rlvryglkpewalraatlnaaqrlgrsdlgliaagrradivvfedlngfsarhvlasgra
    vaeggrmlvdiptcdttvlkgsmklplrmandflvksqgakvrlatidrprftqwgetea
    dvkdgfvvppegatmisvthrhgmaepttktgfltgwgrwngafattvshdshnltvfgg
    nagdmalaanavigtgggmavasegkvtailplplsglvsdapleevarafedlreavgk
    vvewqppylvfkacfgatlacnigphqtdmgiadvltgkvmespvie