PDB entry 3nq8

View 3nq8 on RCSB PDB site
Description: Optimization of the in silico designed Kemp eliminase KE70 by computational design and directed evolution R4 8/5A
Deposited on 2010-06-29, released 2011-02-09
The last revision was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.175
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribose phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NQ8
  • Heterogens: NO3, BEN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nq8A (A:)
    matdlkasslralklmhlatsandddtdenvialchqaktpvgttdaifiyprfipiark
    tlkeqgtpeirictstnfphgnddidialaetraaiaygadgvavvfpyralmagneqvg
    fdlvkackeacaaanvllsviietgelkdealirkaseisikagadyivtstgkvavgat
    pesarimmevirdmgventvgfipvggvrtaedaqkylaiadelfgadwadarhyafgas
    gsllasllkalghgdgksassygslehhh
    

    Sequence, based on observed residues (ATOM records):
    >3nq8A (A:)
    lkasslralklmhlatsanddtdenvialchqaktpvgttdaifiyprfipiarktlkeq
    gtpeirictstnfphgnddidialaetraaiaygadgvavvfpyralmagneqvgfdlvk
    ackeacaaanvllsviietgelkdealirkaseisikagadyivtstgkvavgatpesar
    immevirdmgventvgfipvggvrtaedaqkylaiadelfgadwadarhyafgasgslla
    sllkal