PDB entry 3nq4

View 3nq4 on RCSB PDB site
Description: 30mer structure of Lumazine synthase from Salmonella typhimurium LT2
Deposited on 2010-06-29, released 2011-06-08
The last revision was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.256
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ribH, STM0417
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '1':
    Sequence, based on SEQRES records:
    >3nq41 (1:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq41 (1:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain '2':
    Sequence, based on SEQRES records:
    >3nq42 (2:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq42 (2:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain '3':
    Sequence, based on SEQRES records:
    >3nq43 (3:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq43 (3:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain '4':
    Sequence, based on SEQRES records:
    >3nq44 (4:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq44 (4:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nq4A (A:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4A (A:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nq4B (B:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4B (B:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nq4C (C:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4C (C:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nq4D (D:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4D (D:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nq4E (E:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4E (E:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3nq4F (F:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4F (F:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3nq4G (G:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4G (G:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3nq4H (H:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4H (H:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >3nq4I (I:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4I (I:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >3nq4J (J:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4J (J:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >3nq4K (K:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4K (K:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >3nq4L (L:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4L (L:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >3nq4M (M:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4M (M:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >3nq4N (N:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4N (N:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >3nq4O (O:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4O (O:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >3nq4P (P:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4P (P:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >3nq4Q (Q:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4Q (Q:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >3nq4R (R:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4R (R:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >3nq4S (S:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4S (S:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >3nq4T (T:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4T (T:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >3nq4U (U:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4U (U:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >3nq4V (V:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4V (V:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >3nq4W (W:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4W (W:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >3nq4X (X:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4X (X:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >3nq4Y (Y:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4Y (Y:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai
    

  • Chain 'Z':
    Sequence, based on SEQRES records:
    >3nq4Z (Z:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkaika
    

    Sequence, based on observed residues (ATOM records):
    >3nq4Z (Z:)
    mniikanvaapdarvaitiarfnqfindslldgavdaltrigqvkddnitvvwvpgayel
    platealaksgkydavvalgtvirggtahfeyvaggasnglasvaqdsgvpvafgvltte
    sieqaieragtkagnkgaeaaltaleminvlkai