PDB entry 3npz

View 3npz on RCSB PDB site
Description: Prolactin Receptor (PRLR) Complexed with the Natural Hormone (PRL)
Deposited on 2010-06-29, released 2010-10-06
The last revision was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 3.35 Å
R-factor: 0.237
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prolactin
    Species: Homo sapiens [TaxId:9606]
    Gene: hCG_36753, PRL, RP3-404K8.1-001
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Prolactin receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRLR
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Prolactin receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PRLR
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3npzA (A:)
    lpicpggaarcqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainscht
    sslatpedkeqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveie
    eqtkrllegmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdsh
    kidnylkllkcriihnnnc
    

    Sequence, based on observed residues (ATOM records):
    >3npzA (A:)
    piccqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainschtsslatpe
    dkeqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrll
    egmelivsqvhpetkypvwsglpsladeesrlsayynllhclrrdshkidnylkllkcri
    ihnnnc
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3npzB (B:)
    qsppgkpeihkcrspdketftcwwnpgtdgglptnysltyskegekttyecpdyktsgpn
    scffskqytsiwkiyiitvnatnqmgssssdplyvdvtyivepepprnltlevkqlkdkk
    tylwvkwspptitdvktgwftmeyeirlkpeeaeeweihftghqtqfkvfdlypgqkylv
    qtrckpdhgywsrwsqessvempndftlkdrsrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3npzB (B:)
    qsppgkpeihkcrspdketftcwwnpgtdgglptnysltyskegekttyecpdyktsgpn
    scffskqytsiwkiyiitvnatnqmgssssdplyvdvtyivepepprnltlevkqlkkty
    lwvkwspptitdvktgwftmeyeirlkpeeaeeweihftghqtqfkvfdlypgqkylvqt
    rckpdhgywsrwsqessvempn
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3npzC (C:)
    qsppgkpeihkcrspdketftcwwnpgtdgglptnysltyskegekttyecpdyktsgpn
    scffskqytsiwkiyiitvnatnqmgssssdplyvdvtyivepepprnltlevkqlkdkk
    tylwvkwspptitdvktgwftmeyeirlkpeeaeeweihftghqtqfkvfdlypgqkylv
    qtrckpdhgywsrwsqessvempndftlkdrsrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3npzC (C:)
    qsppgkpeihkcrspdketftcwwnpgtdgglptnysltyskegekttyecpdyktsgpn
    scffskqytsiwkiyiitvnatnqmgssssdplyvdvtyivepepprnltlevkqkktyl
    wvkwspptitdvktgwftmeyeirlkpeeeweihftghqtqfkvfdlypgqkylvqtrck
    pdhgywsrwsqessvempn