PDB entry 3npy

View 3npy on RCSB PDB site
Description: Crystal Structure of Tyrosinase from Bacillus megaterium soaked in CuSO4
Class: oxidoreductase
Keywords: tyrosinase, type3 copper proteins, Bacillus megaterium, oxidoreductase
Deposited on 2010-06-29, released 2010-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.25
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosinase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3npya_
  • Chain 'B':
    Compound: tyrosinase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3npyb_
  • Heterogens: CU, ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3npyA (A:)
    msnkyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaah
    mssaflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnp
    ikdfivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtp
    pwdmtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwav
    wqiihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydielrkskrsshhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3npyA (A:)
    yrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmssa
    flpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikdf
    ivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwdm
    tsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqii
    hnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3npyB (B:)
    msnkyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaah
    mssaflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnp
    ikdfivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtp
    pwdmtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwav
    wqiihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydielrkskrsshhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3npyB (B:)
    kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
    aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
    fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
    mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
    ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydi