PDB entry 3npp

View 3npp on RCSB PDB site
Description: crystal structure of a pfam duf1093 family protein (bsu39620) from bacillus subtilis at 2.15 a resolution
Deposited on 2010-06-28, released 2010-07-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pfam DUF1093 family protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yxeA, BSU39620, HS74A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54940 (1-86)
      • leader sequence (0)
  • Chain 'B':
    Compound: Pfam DUF1093 family protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yxeA, BSU39620, HS74A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54940 (1-86)
      • leader sequence (0)
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nppA (A:)
    grfnpfihqqdvyvqidrdgrhlspggteytldgynasgkkeevtffagkelrknaylkv
    kakgkyvetweevkfedmpdsvqsklk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3nppB (B:)
    grfnpfihqqdvyvqidrdgrhlspggteytldgynasgkkeevtffagkelrknaylkv
    kakgkyvetweevkfedmpdsvqsklk