PDB entry 3npo

View 3npo on RCSB PDB site
Description: Bovine beta lactoglobulin unliganded form
Class: transport protein
Keywords: beta-lactoglobulin, lipocalin, bovine milk, TRANSPORT PROTEIN
Deposited on 2010-06-28, released 2010-07-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.216
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-lactoglobulin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02754 (0-161)
  Domains in SCOPe 2.01: d3npoa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3npoA (A:)
  livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
  wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
  clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi