PDB entry 3npi

View 3npi on RCSB PDB site
Description: crystal structure of a tetr family regulatory protein (dip1788) from corynebacterium diphtheriae at 2.96 a resolution
Deposited on 2010-06-28, released 2010-08-18
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TetR family regulatory protein
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DIP1788
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: TetR family regulatory protein
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DIP1788
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3npiA (A:)
    gmnessthdsvaddptevstdtvldialslfselgfsdakleaiakksgmskrmihyhfg
    dkrglyiccleeavrrlrptaeemylasavpvegvrtiveavfhryvqhpeavrmlqmen
    lhhygkvaeasplsdqsaitlqldrllmlgqdagafrpgisaqdvftliasiavfrinsr
    sttlnlygidmmngdntdgmrrmavdtvlafltsnlksadedsylsrpllstvtehvdee
    gsyevaadpfs
    

    Sequence, based on observed residues (ATOM records):
    >3npiA (A:)
    tevstdtvldialslfselgfsdakleaiakksgmskrmihyhfgdkrglyiccleeavr
    rlrptaeemylasavpvegvrtiveavfhryvqhpeavrmlqmenlhhygkvaeasplsd
    qsaitlqldrllmlgqdagafrpgisaqdvftliasiavfrinsrsttlnlygidmmngd
    ntdgmrrmavdtvlafltsnlksadedsylsrp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3npiB (B:)
    gmnessthdsvaddptevstdtvldialslfselgfsdakleaiakksgmskrmihyhfg
    dkrglyiccleeavrrlrptaeemylasavpvegvrtiveavfhryvqhpeavrmlqmen
    lhhygkvaeasplsdqsaitlqldrllmlgqdagafrpgisaqdvftliasiavfrinsr
    sttlnlygidmmngdntdgmrrmavdtvlafltsnlksadedsylsrpllstvtehvdee
    gsyevaadpfs
    

    Sequence, based on observed residues (ATOM records):
    >3npiB (B:)
    vstdtvldialslfselgfsdakleaiakksgmskrmihyhfgdkrglyiccleeavrrl
    rptaeemylasavpvegvrtiveavfhryvqhpeavrmlqmenlhhygkvaeasplsdqs
    aitlqldrllmlgqdagafrpgisaqdvftliasiavfrinsrsttlnlygidmmngdnt
    dgmrrmavdtvlafltsnlksadedsylsr