PDB entry 3npg

View 3npg on RCSB PDB site
Description: crystal structure of a protein with unknown function from duf364 family (ph1506) from pyrococcus horikoshii at 2.70 a resolution
Deposited on 2010-06-28, released 2010-09-29
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized DUF364 family protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1506
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59175 (1-248)
      • leader sequence (0)
  • Chain 'B':
    Compound: uncharacterized DUF364 family protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1506
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: uncharacterized DUF364 family protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1506
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: uncharacterized DUF364 family protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1506
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3npgA (A:)
    gmngmllsrikkkamelaedlklvdfsfglpytwvlvegiegralgvamtlpeevqrytn
    sieepsllefidkadslniiertlgvaainavsqyyidlreakwidvteliqqdeikria
    iignmppvvrtlkekyevyvfernmklwdrdtysdtleyhilpevdgiiasascivngtl
    dmildrakkaklivitgptgqllpeflkgtkvthlasmkvtniekalvklklgsfkgfes
    esikyviev
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3npgB (B:)
    gmngmllsrikkkamelaedlklvdfsfglpytwvlvegiegralgvamtlpeevqrytn
    sieepsllefidkadslniiertlgvaainavsqyyidlreakwidvteliqqdeikria
    iignmppvvrtlkekyevyvfernmklwdrdtysdtleyhilpevdgiiasascivngtl
    dmildrakkaklivitgptgqllpeflkgtkvthlasmkvtniekalvklklgsfkgfes
    esikyviev
    

    Sequence, based on observed residues (ATOM records):
    >3npgB (B:)
    mllsrikkkamelaedlklvdfsfglpytwvlvegiegralgvamtlpeevqrytnsiee
    psllefidkadslniiertlgvaainavsqyyidlreakwtelideikriaiignmppvv
    rtlkekyevyvfernmklwdrdtysdtleyhilpevdgiiasascivngtldmildrakk
    aklivitgptgqllpeflkgtkvthlasmkvtniekalvklklgsfkgfesesikyviev
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3npgC (C:)
    gmngmllsrikkkamelaedlklvdfsfglpytwvlvegiegralgvamtlpeevqrytn
    sieepsllefidkadslniiertlgvaainavsqyyidlreakwidvteliqqdeikria
    iignmppvvrtlkekyevyvfernmklwdrdtysdtleyhilpevdgiiasascivngtl
    dmildrakkaklivitgptgqllpeflkgtkvthlasmkvtniekalvklklgsfkgfes
    esikyviev
    

    Sequence, based on observed residues (ATOM records):
    >3npgC (C:)
    gmllsrikkkamelaedlklvdfsfglpytwvlvegiegralgvamtlpeevqrytnsie
    epsllefidkadslniiertlgvaainavsqyyidlreakwidvteliqqdeikriaiig
    nmppvvrtlkekyevyvfernmklwdrdtysdtleyhilpevdgiiasascivngtldmi
    ldrakkaklivitgptgqllpeflkgtkvthlasmkvtniekalvklklgsfkgfesesi
    kyviev
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3npgD (D:)
    gmngmllsrikkkamelaedlklvdfsfglpytwvlvegiegralgvamtlpeevqrytn
    sieepsllefidkadslniiertlgvaainavsqyyidlreakwidvteliqqdeikria
    iignmppvvrtlkekyevyvfernmklwdrdtysdtleyhilpevdgiiasascivngtl
    dmildrakkaklivitgptgqllpeflkgtkvthlasmkvtniekalvklklgsfkgfes
    esikyviev
    

    Sequence, based on observed residues (ATOM records):
    >3npgD (D:)
    mllsrikkkamelaedlklvdfsfglpytwvlvegiegralgvamtlpeevqrytnsiee
    psllefidkadslniiertlgvaainavsqyyidlreakwidvteliqqdeikriaiign
    mppvvrtlkekyevyvfernmklwdrdtysdtleyhilpevdgiiasascivngtldmil
    drakkaklivitgptgqllpeflkgtkvthlasmkvtniekalvklklgsfkgfesesik
    yviev