PDB entry 3npf

View 3npf on RCSB PDB site
Description: Crystal structure of a putative dipeptidyl-peptidase VI (BACOVA_00612) from Bacteroides ovatus at 1.72 A resolution
Deposited on 2010-06-28, released 2010-07-28
The last revision was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.142
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative dipeptidyl-peptidase VI
    Species: Bacteroides ovatus [TaxId:411476]
    Gene: BACOVA_00612
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: putative dipeptidyl-peptidase VI
    Species: Bacteroides ovatus [TaxId:411476]
    Gene: BACOVA_00612
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3npfA (A:)
    gqeirpmpadsaygvvhisvcnlreegkftsgmstqallgmpvkvlqyngwyeiqtpddy
    tgwvhrmvitpmskerydewnraekivvtshygfayekpdessqpvsdvvagnrlkwegs
    kghfyqvsypdgrkaylsksisqpeagwraslkqdvesiietaysmmgipylwagtsskg
    vdcsglvrtvlfmhdiiiprdasqqayvgehidiapdfsnvkrgdlvffgrkataerkeg
    ishvgiylgnkqfihalgdvhvssmnpadqnydefntkrllfavrflpyinkekgmnttn
    knpfyq
    

    Sequence, based on observed residues (ATOM records):
    >3npfA (A:)
    qeirpmpadsaygvvhisvcnlreegkftsgmstqallgmpvkvlqyngwyeiqtpddyt
    gwvhrmvitpmskerydewnraekivvtshygfayekpdessqpvsdvvagnrlkwegsk
    ghfyqvsypdgrkaylsksisqpeagwraslkqdvesiietaysmmgipylwagtsskgv
    dcsglvrtvlfmhdiiiprdasqqayvgehidiapdfsnvkrgdlvffgrkataerkegi
    shvgiylgnkqfihalgdvhvssmnpadqnydefntkrllfavrflpyinkekgmnttnk
    npfyq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3npfB (B:)
    gqeirpmpadsaygvvhisvcnlreegkftsgmstqallgmpvkvlqyngwyeiqtpddy
    tgwvhrmvitpmskerydewnraekivvtshygfayekpdessqpvsdvvagnrlkwegs
    kghfyqvsypdgrkaylsksisqpeagwraslkqdvesiietaysmmgipylwagtsskg
    vdcsglvrtvlfmhdiiiprdasqqayvgehidiapdfsnvkrgdlvffgrkataerkeg
    ishvgiylgnkqfihalgdvhvssmnpadqnydefntkrllfavrflpyinkekgmnttn
    knpfyq
    

    Sequence, based on observed residues (ATOM records):
    >3npfB (B:)
    dsaygvvhisvcnlreegkftsgmstqallgmpvkvlqyngwyeiqtpddytgwvhrmvi
    tpmskerydewnraekivvtshygfayekpdessqpvsdvvagnrlkwegskghfyqvsy
    pdgrkaylsksisqpeagwraslkqdvesiietaysmmgipylwagtsskgvdcsglvrt
    vlfmhdiiiprdasqqayvgehidiapdfsnvkrgdlvffgrkataerkegishvgiylg
    nkqfihalgdvhvssmnpadqnydefntkrllfavrflpyinkekgmnttnknpfyq