PDB entry 3npe

View 3npe on RCSB PDB site
Description: structure of vp14 in complex with oxygen
Deposited on 2010-06-28, released 2010-11-10
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 9-cis-epoxycarotenoid dioxygenase 1, chloroplastic
    Species: Zea mays [TaxId:4577]
    Gene: VP14
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE2, OXY, OH, DIO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3npeA (A:)
    kaeggkkqlnlfqraaaaaldafeegfvanvlerphglpstadpavqiagnfapvgerpp
    vhelpvsgrippfidgvyarnganpcfdpvaghhlfdgdgmvhalrirngaaesyacrft
    etarlrqeraigrpvfpkaigelhghsgiarlalfyaraacglvdpsagtgvanaglvyf
    ngrllamseddlpyhvrvaddgdletvgrydfdgqlgcamiahpkldpatgelhalsydv
    ikrpylkyfyfrpdgtksddveipleqptmihdfaitenlvvvpdhqvvfklqemlrggs
    pvvldaaktsrfgvlpkhaadasemawvdvpdcfcfhlwnawedeatgevvvigscmtpa
    dsifnesderlesvlteirldartgrstrravlppsqqvnlevgmvnrnllgretryayl
    avaepwpkvsgfakvdlstgeltkfeygegrfggepcfvpmdpaaahprgeddgyvltfv
    hderagtsellvvnaadmrleatvqlpsrvpfgfhgtfitgqeleaqaa
    

    Sequence, based on observed residues (ATOM records):
    >3npeA (A:)
    qlnlfqraaaaaldafeegfvanvlerphglpstadpavqiagnfapvgerppvhelpvs
    grippfidgvyarnganpcfdpvaghhlfdgdgmvhalrirngaaesyacrftetarlrq
    eraigrpvfpkaigelhghsgiarlalfyaraacglvdpsagtgvanaglvyfngrllam
    seddlpyhvrvaddgdletvgrydfdgqlgcamiahpkldpatgelhalsydvikrpylk
    yfyfrpdgtksddveipleqptmihdfaitenlvvvpdhqvvfklqemlrggspvvldaa
    ktsrfgvlpkhaadasemawvdvpdcfcfhlwnawedeatgevvvigscmtpadsifnes
    derlesvlteirldartgrstrravlppsqqvnlevgmvnrnllgretryaylavaepwp
    kvsgfakvdlstgeltkfeygegrfggepcfvpmdpaaahprgeddgyvltfvhderagt
    sellvvnaadmrleatvqlpsrvpfgfhgtfitgqeleaqaa