PDB entry 3npc

View 3npc on RCSB PDB site
Description: Crystal structure of JNK2 complexed with BIRB796
Class: transferase/transferase inhibitor
Keywords: DFG-out, Protein kinase, Transferase, ATP Binding, type II kinase inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-06-28, released 2010-08-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.214
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK9, JNK2, PRKM9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45984
      • engineered mutation (7)
      • engineered mutation (13)
      • engineered mutation (202-203)
      • engineered mutation (249-250)
    Domains in SCOPe 2.04: d3npca_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK9, JNK2, PRKM9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45984
      • engineered mutation (7)
      • engineered mutation (13)
      • engineered mutation (202-203)
      • engineered mutation (249-250)
    Domains in SCOPe 2.04: d3npcb_
  • Heterogens: B96, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3npcA (A:)
    mskskvdnqfysvevadstftvlkryqqlkpigsgaqgivcaafdtvlginvavkklsrp
    fqnqthakrayrelvllkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvih
    meldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartactnf
    mmtpyvvtryyrapevilgmgyaanvdiwsvgcimgelvkgcvifqgtdhidqwnkvieq
    lgtpsaefmaalqptvrnyvenrpkypgikfeelfpdwifpseserdkiktsqardllsk
    mlvidpdkrisvdealrhpyitvwydpaeaeapppqiydaqleerehaieewkeliykev
    mdwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3npcA (A:)
    dnqfysvevadstftvlkryqqlkpigsgaqgivcaafdtvlginvavkklsrpfqnqth
    akrayrelvllkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvihmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartactnfmmtpyv
    vtryyrapevilgmgyaanvdiwsvgcimgelvkgcvifqgtdhidqwnkvieqlgtpsa
    efmaalqptvrnyvenrpkypgikfeelfpdwifpseserdkiktsqardllskmlvidp
    dkrisvdealrhpyitvwydpaeaeapppqiydaqleerehaieewkeliykevmdw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3npcB (B:)
    mskskvdnqfysvevadstftvlkryqqlkpigsgaqgivcaafdtvlginvavkklsrp
    fqnqthakrayrelvllkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvih
    meldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartactnf
    mmtpyvvtryyrapevilgmgyaanvdiwsvgcimgelvkgcvifqgtdhidqwnkvieq
    lgtpsaefmaalqptvrnyvenrpkypgikfeelfpdwifpseserdkiktsqardllsk
    mlvidpdkrisvdealrhpyitvwydpaeaeapppqiydaqleerehaieewkeliykev
    mdwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3npcB (B:)
    nqfysvevadstftvlkryqqlkpigsgaqgivcaafdtvlginvavkklsrpfqnqtha
    krayrelvllkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvihmeldher
    msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartactnfmmtpyvv
    tryyrapevilgmgyaanvdiwsvgcimgelvkgcvifqgtdhidqwnkvieqlgtpsae
    fmaalqptvrnyvenrpkypgikfeelfpdwifpseserdkiktsqardllskmlvidpd
    krisvdealrhpyitvwydpaeaeapppqiydaqleerehaieewkeliykevmdw