PDB entry 3np3

View 3np3 on RCSB PDB site
Description: C112D/M121E Pseudomonas Aeruginosa Azurin
Class: electron transport
Keywords: Cupredoxin, azurin, ELECTRON TRANSPORT
Deposited on 2010-06-27, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (111)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d3np3a_
  • Heterogens: CU, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3np3A (A:)
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffdtfpghsal
ekgtltlk