PDB entry 3np1

View 3np1 on RCSB PDB site
Description: crystal structure of the complex of nitrophorin 1 from rhodnius prolixus with cyanide
Class: nitric oxide transport
Keywords: nitric oxide transport, ferric heme, histamine, antihistamine, vasodilator, lipocalin, cyanide
Deposited on 1998-01-22, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrophorin 1
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3np1a_
  • Chain 'B':
    Compound: nitrophorin 1
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3np1b_
  • Heterogens: CYN, PO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3np1A (A:)
    kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
    dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih
    tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks
    lltk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3np1B (B:)
    kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
    dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih
    tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks
    lltk