SCOP: Structural Classification of Proteins and ASTRAL

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

PDB entry 3np0

View 3np0 on RCSB PDB site
Description: Crystal Structure of Pd(allyl)/apo-E45C/H49A/R52H-rHLFr
Class: Metal Binding Protein
Keywords: Metal Binding Protein
Deposited on 2010-06-27, released 2010-12-22
The last revision prior to the SCOP 1.75B freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.199
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

Chain 'X':
Compound: ferritin light chain
Species: Equus caballus [TaxId:9796]
Gene: FTL
Domains in SCOP 1.75B: d3np0x_
Heterogens: SO4, PLL, CD, EDO, HOH

PDB Chain Sequences:

Chain 'X':
Sequence; same for both SEQRES and ATOM records: (download)

>3np0X (X:)
ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalcgvcaffhelaeekre
gaerllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaq
adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd