PDB entry 3noz

View 3noz on RCSB PDB site
Description: Crystal Structure of Pd(allyl)/apo-E45C/R52H-rHLFr
Class: metal binding protein
Keywords: Metal Binding Protein
Deposited on 2010-06-27, released 2010-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.196
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: ferritin light chain
    Species: Equus caballus [TaxId:9796]
    Gene: FTL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02791 (0-173)
      • engineered mutation (44)
      • engineered mutation (51)
    Domains in SCOPe 2.07: d3nozx_
  • Heterogens: SO4, CD, PLL, EDO, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nozX (X:)
    ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalcgvchffhelaeekre
    gaerllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaq
    adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd