PDB entry 3nox

View 3nox on RCSB PDB site
Description: Crystal structure of human DPP-IV in complex with Sa-(+)-(6-(aminomethyl)-5-(2,4-dichlorophenyl)-7-methylimidazo[1,2-a]pyrimidin-2-yl)(morpholino)methanone
Class: hydrolase
Keywords: exopeptidase, alpha/beta hydrolase fold, beta barrel, beta propeller, dpp4, dimer, protein:inhibitor complex, aminopeptidase, glycoprotein, membrane, protease, secreted, serine protease, signal-anchor, transmembrane, hydrolase
Deposited on 2010-06-25, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.198
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dipeptidyl-peptidase 4 (CD26, adenosine deaminase complexing protein 2)
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, hCG_39008
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3noxa1, d3noxa2
  • Chain 'B':
    Compound: Dipeptidyl-peptidase 4 (CD26, adenosine deaminase complexing protein 2)
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, hCG_39008
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3noxb1, d3noxb2
  • Heterogens: NAG, 6A5, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3noxA (A:)
    efsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfd
    efghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvt
    wspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalww
    spngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdsl
    ssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgr
    wnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctf
    itkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqy
    ysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldf
    iilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniiva
    sfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvt
    smvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfk
    qveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythms
    hfikqcfslppleqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3noxA (A:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3noxB (B:)
    efsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfd
    efghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvt
    wspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalww
    spngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdsl
    ssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgr
    wnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctf
    itkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqy
    ysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldf
    iilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniiva
    sfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvt
    smvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfk
    qveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythms
    hfikqcfslppleqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3noxB (B:)
    rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslp