PDB entry 3now

View 3now on RCSB PDB site
Description: UNC-45 from Drosophila melanogaster
Deposited on 2010-06-25, released 2011-03-16
The last revision was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.202
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UNC-45 protein, SD10334p
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG2708, Tom34
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nowA (A:)
    naktstkvkqmmdltfdlatpidkrraaannlvvlakeqtgaellykdhciakvasltkv
    ekdqdiyvnmvhlvaalcensvertkgvltelgvpwfmrvldqkhencvstaqfclqtil
    nalsglknkpdskpdkelctrnnreidtlltclvysitdrtisgaardgvielitrnvhy
    talewaerlveirglcrlldvcseledykyesamditgssstiasvclariyenmyydea
    karftdqideyikdkllapdmeskvrvtvaitallngpldvgnqvvaregilqmilamat
    tddelqqrvacecliaasskkdkakalceqgvdilkrlyhskndgirvralvglcklgsy
    ggqdaairpfgdgaalklaeacrrflikpgkdkdirrwaadglayltldaeckekliedk
    asihalmdlarggnqsclygvvttfvnlcnayekqemlpemielakfakqhipeeheldd
    vdfinkritvlanegittalcalakteshnsqeliarvlnavcglkelrgkvvqeggvka
    llrmalegtekgkrhatqalarigitinpevsfsgqrsldvirpllnllqqdctalenfe
    slmaltnlasmnesvrqriikeqgvskieyylmedhlyltraaaqclcnlvmsedvikmf
    egnndrvkflallcededeetatacagalaiitsvsvkccekilaiaswldilhtlianp
    spavqhrgiviilnminageeiakklfetdimellsglgqlpddtrakarevatqclaaa
    eryriiersdnaeipdvfaenskiseiidd
    

    Sequence, based on observed residues (ATOM records):
    >3nowA (A:)
    naktstkvkqmmdltfdlatpidkrraaannlvvlakeqtgaellykdhciakvasltkv
    ekdqdiyvnmvhlvaalcensvertkgvltelgvpwfmrvldqkhencvstaqfclqtil
    nalsglknkpdskpdkelctrnnreidtlltclvysitdrtisgaardgvielitrnvhy
    talewaerlveirglcrlldvcseledykyesamditgssstiasvclariyenmyydea
    karftdqideyikdkllapdmeskvrvtvaitallngpldvgnqvvaregilqmilamat
    tddelqqrvacecliaasskkdkakalceqgvdilkrlyhskndgirvralvglcklgsy
    ggqdaairpfgdgaalklaeacrrflikpgkdkdirrwaadglayltldaeckekliedk
    asihalmdlarggnqsclygvvttfvnlcnayekqemlpemielakfakqhipeeheldd
    vdfinkritvlanegittalcalakteshnsqeliarvlnavcglkelrgkvvqeggvka
    llrmalegtekgkrhatqalarigitinpevsfsgqrsldvirpllnllqqdctalenfe
    slmaltnlasmnesvrqriikeqgvskieyylmedhlyltraaaqclcnlvmsedvikmf
    egnndrvkflallcededeetatacagalaiitsvsvkccekilaiaswldilhtlianp
    spavqhrgiviilnminageeiakklfetdimellsglgqlpddtrakarevatqclaaa
    eryrii