PDB entry 3nov

View 3nov on RCSB PDB site
Description: Crystal Structure of D17E Isocyanide Hydratase from Pseudomonas fluorescens
Deposited on 2010-06-25, released 2010-07-07
The last revision was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.143
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ThiJ/pfpI family protein
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: PFL_4109
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4K977 (3-End)
      • expression tag (0-2)
      • engineered mutation (19)
  • Heterogens: ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3novA (A:)
    gshmavqigfllfpevqqleltgphdvlaslpdvqvhliwkepgpvvassglvlqattsf
    adcppldvicipggtgvgalmedpqalafirqqaararyvtsvctgslvlgaagllqgkr
    atthwayhellaplgaipvhervvrdgnlltgggitagidfaltlaaelfdaataqrvql
    qleyapappfnagspdtapasvvqqarqraadslhkrreitlraaarlaag
    

    Sequence, based on observed residues (ATOM records):
    >3novA (A:)
    gshmavqigfllfpevqqleltgphdvlaslpdvqvhliwkepgpvvassglvlqattsf
    adcppldvicipggtgvgalmedpqalafirqqaararyvtsvctgslvlgaagllqgkr
    atthwayhellaplgaipvhervvrdgnlltgggitagidfaltlaaelfdaataqrvql
    qleyapappfnagspdtapasvvqqarqraadslhkrreitlraaarlaa