PDB entry 3nos

View 3nos on RCSB PDB site
Description: human endothelial nitric oxide synthase with arginine substrate
Class: Oxidoreductase
Keywords: L-ARGININE MONOOXYGENASE, NITRIC OXIDE, HUMAN, ZNS4, Oxidoreductase
Deposited on 1999-02-03, released 2000-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.193
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endothelial Nitric-oxide synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nosa_
  • Chain 'B':
    Compound: endothelial Nitric-oxide synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nosb_
  • Heterogens: ZN, HAR, HEM, H4B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nosA (A:)
    pkfprvknwevgsitydtlsaqaqqdgpctprrclgslvfprklqgrpspgppapeqlls
    qardfinqyyssikrsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcv
    griqwgklqvfdardcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwn
    sqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfll
    ppelvlevplehptlewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtr
    nlcdphryniledvavcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaata
    sfmkhleneqkarggcpadwawivppisgsltpvfhqemvnyflspafryqpdpwkgsaa
    kgtgitr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nosA (A:)
    kfprvknwevgsitydtlsaqaqqdgpctprrclgslvfprqllsqardfinqyyssikr
    sgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgriqwgklqvfdard
    crsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqdgs
    vrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllppelvlevplehptl
    ewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnlcdphryniledva
    vcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasfmkhleneqkargg
    cpadwawivppisgsltpvfhqemvnyflspafryqpdpw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nosB (B:)
    pkfprvknwevgsitydtlsaqaqqdgpctprrclgslvfprklqgrpspgppapeqlls
    qardfinqyyssikrsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcv
    griqwgklqvfdardcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwn
    sqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfll
    ppelvlevplehptlewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtr
    nlcdphryniledvavcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaata
    sfmkhleneqkarggcpadwawivppisgsltpvfhqemvnyflspafryqpdpwkgsaa
    kgtgitr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nosB (B:)
    kfprvknwevgsitydtlsaqaqqdgpctprrclgslvfprqllsqardfinqyyssikr
    sgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgriqwgklqvfdard
    crsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqdgs
    vrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllppelvlevplehptl
    ewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnlcdphryniledva
    vcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasfmkhleneqkargg
    cpadwawivppisgsltpvfhqemvnyflspafryqpdpw