PDB entry 3nor

View 3nor on RCSB PDB site
Description: Crystal Structure of T102S Isocyanide Hydratase from Pseudomonas fluorescens
Deposited on 2010-06-25, released 2010-07-07
The last revision was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.158
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ThiJ/pfpI family protein
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: PFL_4109
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4K977 (3-230)
      • expression tag (0-2)
      • engineered mutation (104)
  • Heterogens: CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3norA (A:)
    gshmavqigfllfpevqqldltgphdvlaslpdvqvhliwkepgpvvassglvlqattsf
    adcppldvicipggtgvgalmedpqalafirqqaararyvtsvcsgslvlgaagllqgkr
    atthwayhellaplgaipvhervvrdgnlltgggitagidfaltlaaelfdaataqrvql
    qleyapappfnagspdtapasvvqqarqraadslhkrreitlraaarlaag