PDB entry 3noq

View 3noq on RCSB PDB site
Description: Crystal Structure of C101S Isocyanide Hydratase from Pseudomonas fluorescens
Deposited on 2010-06-25, released 2010-07-07
The last revision was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.125
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ThiJ/pfpI family protein
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: PFL_4109
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4K977 (5-End)
      • engineered mutation (103)
      • expression tag (3-4)
      • engineered mutation (105)
  • Chain 'B':
    Compound: ThiJ/pfpI family protein
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: PFL_4109
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4K977 (3-End)
      • engineered mutation (101)
      • expression tag (1-2)
      • engineered mutation (103)
  • Heterogens: NHE, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3noqA (A:)
    gshmavqigfllfpevqqldltgphdvlaslpdvqvhliwkepgpvvassglvlqattsf
    adcppldvicipggtgvgalmedpqalafirqqaararyvtsvstgslvlgaagllqgkr
    atthwayhellaplgaipvhervvrdgnlltgggitagidfaltlaaelfdaataqrvql
    qleyapappfnagspdtapasvvqqarqraadslhkrreitlraaarlaag
    

    Sequence, based on observed residues (ATOM records):
    >3noqA (A:)
    mavqigfllfpevqqldltgphdvlaslpdvqvhliwkepgpvvassglvlqattsfadc
    ppldvicipggtgvgalmedpqalafirqqaararyvtsvstgslvlgaagllqgkratt
    hwayhellaplgaipvhervvrdgnlltgggitagidfaltlaaelfdaataqrvqlqle
    yapappfnagspdtapasvvqqarqraadslhkrreitlraaarlaa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3noqB (B:)
    gshmavqigfllfpevqqldltgphdvlaslpdvqvhliwkepgpvvassglvlqattsf
    adcppldvicipggtgvgalmedpqalafirqqaararyvtsvstgslvlgaagllqgkr
    atthwayhellaplgaipvhervvrdgnlltgggitagidfaltlaaelfdaataqrvql
    qleyapappfnagspdtapasvvqqarqraadslhkrreitlraaarlaag
    

    Sequence, based on observed residues (ATOM records):
    >3noqB (B:)
    shmavqigfllfpevqqldltgphdvlaslpdvqvhliwkepgpvvassglvlqattsfa
    dcppldvicipggtgvgalmedpqalafirqqaararyvtsvstgslvlgaagllqgkra
    tthwayhellaplgaipvhervvrdgnlltgggitagidfaltlaaelfdaataqrvqlq
    leyapappfnagspdtapasvvqqarqraadslhkrreitlraaarlaa