PDB entry 3nop

View 3nop on RCSB PDB site
Description: Light-induced intermediate structure L1 of Pseudomonas aeruginosa bacteriophytochrome
Class: signaling protein
Keywords: intermediate structure, chromophore binding pocket, difference Fourier method, SIGNALING PROTEIN
Deposited on 2010-06-25, released 2012-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Bacteriophytochrome
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bphP, PA4117
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nopc1, d3nopc2, d3nopc3
  • Heterogens: BLA

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nopC (C:)
    mtsitpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsylt
    qeqvgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsi
    tsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrre
    dlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvl
    rsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcs
    aiverleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlg
    grtlsirgdferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqe
    sgwifwfrheevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdla
    iaeklrldlmelclnhalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nopC (C:)
    itpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeq
    vgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadtlsitsf
    tlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaesrredle
    sylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsysvlrsv
    spihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsqvcsaiv
    erleqgriaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrt
    lsirgdferqagnvlqrlqrdperdiyhtdnwgdccgvlairfhrqesgwifwfrheevh
    rirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldlmelc
    lnh