PDB entry 3noo

View 3noo on RCSB PDB site
Description: Crystal Structure of C101A Isocyanide Hydratase from Pseudomonas fluorescens
Deposited on 2010-06-25, released 2010-07-07
The last revision was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 1.03 Å
R-factor: 0.13
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ThiJ/pfpI family protein
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: PFL_4109
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4K977 (0-227)
      • expression tag (0-2)
      • engineered mutation (103)
      • engineered mutation (100)
  • Chain 'B':
    Compound: ThiJ/pfpI family protein
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: PFL_4109
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4K977 (Start-230)
      • expression tag (4-5)
      • engineered mutation (106)
      • engineered mutation (103)
  • Heterogens: EDO, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nooA (A:)
    gshmavqigfllfpevqqldltgphdvlaslpdvqvhliwkepgpvvassglvlqattsf
    adcppldvicipggtgvgalmedpqalafirqqaararyvtsvatgslvlgaagllqgkr
    atthwayhellaplgaipvhervvrdgnlltgggitagidfaltlaaelfdaataqrvql
    qleyapappfnagspdtapasvvqqarqraadslhkrreitlraaarlaag
    

    Sequence, based on observed residues (ATOM records):
    >3nooA (A:)
    gshmavqigfllfpevqqldltgphdvlaslpdvqvhliwkepgpvvassglvlqattsf
    adcppldvicipggtgvgalmedpqalafirqqaararyvtsvatgslvlgaagllqgkr
    atthwayhellaplgaipvhervvrdgnlltgggitagidfaltlaaelfdaataqrvql
    qleyapappfnagspdtapasvvqqarqraadslhkrreitlraaarl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nooB (B:)
    gshmavqigfllfpevqqldltgphdvlaslpdvqvhliwkepgpvvassglvlqattsf
    adcppldvicipggtgvgalmedpqalafirqqaararyvtsvatgslvlgaagllqgkr
    atthwayhellaplgaipvhervvrdgnlltgggitagidfaltlaaelfdaataqrvql
    qleyapappfnagspdtapasvvqqarqraadslhkrreitlraaarlaag
    

    Sequence, based on observed residues (ATOM records):
    >3nooB (B:)
    avqigfllfpevqqldltgphdvlaslpdvqvhliwkepgpvvassglvlqattsfadcp
    pldvicipggtgvgalmedpqalafirqqaararyvtsvatgslvlgaagllqgkratth
    wayhellaplgaipvhervvrdgnlltgggitagidfaltlaaelfdaataqrvqlqley
    apappfnagspdtapasvvqqarqraadslhkrreitlraaarlaag