PDB entry 3nom

View 3nom on RCSB PDB site
Description: Crystal Structure of Zymomonas mobilis Glutaminyl Cyclase (monoclinic form)
Deposited on 2010-06-25, released 2010-11-03
The last revision was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine cyclotransferase
    Species: Zymomonas mobilis [TaxId:555217]
    Gene: ZmobDRAFT_1643
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: glutamine cyclotransferase
    Species: Zymomonas mobilis [TaxId:555217]
    Gene: ZmobDRAFT_1643
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, GOL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nomA (A:)
    mgsthhhhhhssglvprgshmatpsipiydyqivhsyphdtkaftegffyrngyfyestg
    lngrssirkvdiesgktlqqielgkryfgegisdwkdkivgltwknglgfvwnirnlrqv
    rsfnydgegwglthndqylimsdgtpvlrfldpesltpvrtitvtahgeelpelnelewv
    dgeifanvwqtnkivridpetgkvtgiidlngilaeagplpspidvlngiawdkehhrlf
    vtgklwpkvfeitltqrvgghk
    

    Sequence, based on observed residues (ATOM records):
    >3nomA (A:)
    sipiydyqivhsyphdtkaftegffyrngyfyestglngrssirkvdiesgktlqqielg
    kryfgegisdwkdkivgltwknglgfvwnirnlrqvrsfnydgegwglthndqylimsdg
    tpvlrfldpesltpvrtitvtahgeelpelnelewvdgeifanvwqtnkivridpetgkv
    tgiidlngilaeagplpspidvlngiawdkehhrlfvtgklwpkvfeitltqrv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nomB (B:)
    mgsthhhhhhssglvprgshmatpsipiydyqivhsyphdtkaftegffyrngyfyestg
    lngrssirkvdiesgktlqqielgkryfgegisdwkdkivgltwknglgfvwnirnlrqv
    rsfnydgegwglthndqylimsdgtpvlrfldpesltpvrtitvtahgeelpelnelewv
    dgeifanvwqtnkivridpetgkvtgiidlngilaeagplpspidvlngiawdkehhrlf
    vtgklwpkvfeitltqrvgghk
    

    Sequence, based on observed residues (ATOM records):
    >3nomB (B:)
    sipiydyqivhsyphdtkaftegffyrngyfyestglngrssirkvdiesgktlqqielg
    kryfgegisdwkdkivgltwknglgfvwnirnlrqvrsfnydgegwglthndqylimsdg
    tpvlrfldpesltpvrtitvtahgeelpelnelewvdgeifanvwqtnkivridpetgkv
    tgiidlngilaeagplpspidvlngiawdkehhrlfvtgklwpkvfeitltqrv