PDB entry 3nok

View 3nok on RCSB PDB site
Description: crystal structure of myxococcus xanthus glutaminyl cyclase
Deposited on 2010-06-25, released 2010-11-03
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaminyl Cyclase
    Species: Myxococcus xanthus [TaxId:34]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NOK (Start-267)
  • Chain 'B':
    Compound: Glutaminyl Cyclase
    Species: Myxococcus xanthus [TaxId:34]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NOK (Start-267)
  • Heterogens: CA, MES, DDQ, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nokA (A:)
    mgsshhhhhhssglvprgshmsptnrpvpdaggsvqepvrrvahiireyphatnaftqgl
    vfhqghffestghqgtlrqlslesaqpvwmerlgnifaeglasdgerlyqltwtegllft
    wsgmppqrerttrysgegwglcywngklvrsdggtmltfhepdgfalvgavqvklrgqpv
    elinelecangviyaniwhssdvleidpatgtvvgvidasaltravagqvtnpeavlngi
    avepgsgrifmtgklwprlfevrldvvd
    

    Sequence, based on observed residues (ATOM records):
    >3nokA (A:)
    vqepvrrvahiireyphatnaftqglvfhqghffestghqgtlrqlslesaqpvwmerlg
    nifaeglasdgerlyqltwtegllftwsgmppqrerttrysgegwglcywngklvrsdgg
    tmltfhepdgfalvgavqvklrgqpvelinelecangviyaniwhssdvleidpatgtvv
    gvidasaltravagqvtnpeavlngiavepgsgrifmtgklwprlfevrldvvd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nokB (B:)
    mgsshhhhhhssglvprgshmsptnrpvpdaggsvqepvrrvahiireyphatnaftqgl
    vfhqghffestghqgtlrqlslesaqpvwmerlgnifaeglasdgerlyqltwtegllft
    wsgmppqrerttrysgegwglcywngklvrsdggtmltfhepdgfalvgavqvklrgqpv
    elinelecangviyaniwhssdvleidpatgtvvgvidasaltravagqvtnpeavlngi
    avepgsgrifmtgklwprlfevrldvvd
    

    Sequence, based on observed residues (ATOM records):
    >3nokB (B:)
    epvrrvahiireyphatnaftqglvfhqghffestghqgtlrqlslesaqpvwmerlgni
    faeglasdgerlyqltwtegllftwsgmppqrerttrysgegwglcywngklvrsdggtm
    ltfhepdgfalvgavqvklrgqpvelinelecangviyaniwhssdvleidpatgtvvgv
    idasaltravagqvtnpeavlngiavepgsgrifmtgklwprlfevrldvvd