PDB entry 3noe

View 3noe on RCSB PDB site
Description: Crystal Structure of Dihydrodipicolinate synthase from Pseudomonas aeruginosa
Class: lyase
Keywords: Lys biosynthesis pathway, LYASE
Deposited on 2010-06-25, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.202
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrodipicolinate synthase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D1MH64 (0-291)
      • engineered mutation (33)
      • engineered mutation (59)
      • engineered mutation (233)
      • engineered mutation (278)
    Domains in SCOPe 2.07: d3noea_
  • Chain 'B':
    Compound: Dihydrodipicolinate synthase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D1MH64 (0-291)
      • engineered mutation (33)
      • engineered mutation (59)
      • engineered mutation (233)
      • engineered mutation (278)
    Domains in SCOPe 2.07: d3noeb_
  • Heterogens: PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3noeA (A:)
    miagsmvalvtpfdaqgrldwdslaklvdfhlqdgtnaivavgttgesatldveehiqvv
    rrvvdqvkgripviagtganstreavalteaaksggadacllvtpyynkptqegmyqhfr
    hiaeavaipqilynvpgrtscdmlpetverlskvpniigikeatgdlqrakeviervgkd
    flvysgddatavelmllggkgnisvtanvapramsdlcaaamrgdaaaaraindrlmplh
    kalfiesnpipvkwalhemglipegirlpltwlsphchdplrqamrqtgvla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3noeB (B:)
    miagsmvalvtpfdaqgrldwdslaklvdfhlqdgtnaivavgttgesatldveehiqvv
    rrvvdqvkgripviagtganstreavalteaaksggadacllvtpyynkptqegmyqhfr
    hiaeavaipqilynvpgrtscdmlpetverlskvpniigikeatgdlqrakeviervgkd
    flvysgddatavelmllggkgnisvtanvapramsdlcaaamrgdaaaaraindrlmplh
    kalfiesnpipvkwalhemglipegirlpltwlsphchdplrqamrqtgvla