PDB entry 3nod

View 3nod on RCSB PDB site
Description: murine inducible nitric oxide synthase oxygenase dimer (delta 65) with tetrahydrobiopterin and product analogue l-thiocitrulline
Class: oxidoreductase
Keywords: nitric oxide l-arginine monooxygenase, dimer, thiocitrulline nos, oxidoreductase
Deposited on 1998-03-06, released 1999-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.227
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitric oxide synthase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3noda_
  • Chain 'B':
    Compound: nitric oxide synthase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nodb_
  • Heterogens: SO4, HEM, H4B, SCI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nodA (A:)
    qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
    aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
    riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
    qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
    pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
    fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
    fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    nek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nodA (A:)
    qyvriknwgsgeilhdtlhhkatsdsclgsimnpksltrgprdkptpleellphaiefin
    qyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsn
    lqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqlirya
    gyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvle
    vtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqr
    ynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmq
    neyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nodB (B:)
    qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
    aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
    riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
    qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
    pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
    fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
    fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    nek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nodB (B:)
    qyvriknwgsgeilhdtlhhkatssclgsimnpksltrgprdkptpleellphaiefinq
    yygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnl
    qvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryag
    yqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlev
    tmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqry
    nileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqn
    eyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq