PDB entry 3no9

View 3no9 on RCSB PDB site
Description: Crystal Structure of apo fumarate hydratase from Mycobacterium tuberculosis
Class: lyase
Keywords: apo, Structural Genomics, TB Structural Genomics Consortium, fumarate hydratase, tricarboxylic acid cycle, lyase class I, LYASE, TBSGC
Deposited on 2010-06-25, released 2010-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.208
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fumarate hydratase class II
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: fum, fumC, MT1130, MTV017.51c, Rv1098c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3no9a_
  • Chain 'B':
    Compound: fumarate hydratase class II
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: fum, fumC, MT1130, MTV017.51c, Rv1098c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3no9b_
  • Chain 'C':
    Compound: fumarate hydratase class II
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: fum, fumC, MT1130, MTV017.51c, Rv1098c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3no9c_
  • Chain 'D':
    Compound: fumarate hydratase class II
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: fum, fumC, MT1130, MTV017.51c, Rv1098c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3no9d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3no9A (A:)
    smavdadsanyriehdtmgevrvpakalwraqtqravenfpisgrglertqiralgllkg
    acaqvnsdlgllapekadaiiaaaaeiadgqhddqfpidvfqtgsgtssnmntneviasi
    aakggvtlhpnddvnmsqssndtfptathiaateaavahlipalqqlhdalaakaldwht
    vvksgrthlmdavpvtlgqefsgyarqieagiervraclprlgelaiggtavgtglnapd
    dfgvrvvavlvaqtglselrtaansfeaqaardglveasgalrtiavsltkiandirwmg
    sgpltglaeiqlpdlqpgssimpgkvnpvlpeavtqvaaqvigndaaiawggangafeln
    vyipmmarnilesfklltnvsrlfaqrciagltanvehlrrlaesspsivtplnsaigye
    eaaavakqalkerktirqtvidrgligdrlsiedldrrldvlamakaeqldsdrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3no9A (A:)
    sanyriehdtmgevrvpakalwraqtqravenfpisgrglertqiralgllkgacaqvns
    dlgllapekadaiiaaaaeiadgqhddqfpidvfqtgsgtssnmntneviasiaakggvt
    lhpnddvnmsqssndtfptathiaateaavahlipalqqlhdalaakaldwhtvvksgrt
    hlmdavpvtlgqefsgyarqieagiervraclprlgelaiggtavgtglnapddfgvrvv
    avlvaqtglselrtaansfeaqaardglveasgalrtiavsltkiandirwmgsgpltgl
    aeiqlpdlqpgkvnpvlpeavtqvaaqvigndaaiawggangafelnvyipmmarniles
    fklltnvsrlfaqrciagltanvehlrrlaesspsivtplnsaigyeeaaavakqalker
    ktirqtvidrgligdlsiedldrrldvlamaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3no9B (B:)
    smavdadsanyriehdtmgevrvpakalwraqtqravenfpisgrglertqiralgllkg
    acaqvnsdlgllapekadaiiaaaaeiadgqhddqfpidvfqtgsgtssnmntneviasi
    aakggvtlhpnddvnmsqssndtfptathiaateaavahlipalqqlhdalaakaldwht
    vvksgrthlmdavpvtlgqefsgyarqieagiervraclprlgelaiggtavgtglnapd
    dfgvrvvavlvaqtglselrtaansfeaqaardglveasgalrtiavsltkiandirwmg
    sgpltglaeiqlpdlqpgssimpgkvnpvlpeavtqvaaqvigndaaiawggangafeln
    vyipmmarnilesfklltnvsrlfaqrciagltanvehlrrlaesspsivtplnsaigye
    eaaavakqalkerktirqtvidrgligdrlsiedldrrldvlamakaeqldsdrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3no9B (B:)
    anyriehdtmgevrvpakalwraqtqravenfpisgrglertqiralgllkgacaqvnsd
    lgllapekadaiiaaaaeiadgqhddqfpidvfqtgsgtssnmntneviasiaakggvtl
    hpnddvnmsqssndtfptathiaateaavahlipalqqlhdalaakaldwhtvvksgrth
    lmdavpvtlgqefsgyarqieagiervraclprlgelaiggtavgtglnapddfgvrvva
    vlvaqtglselrtaansfeaqaardglveasgalrtiavsltkiandirwmgsgpltgla
    eiqlpdlqpgkvnpvlpeavtqvaaqvigndaaiawggangafelnvyipmmarnilesf
    klltnvsrlfaqrciagltanvehlrrlaesspsivtplnsaigyeeaaavakqalkerk
    tirqtvidrgligdlsiedldrrldvlamaka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3no9C (C:)
    smavdadsanyriehdtmgevrvpakalwraqtqravenfpisgrglertqiralgllkg
    acaqvnsdlgllapekadaiiaaaaeiadgqhddqfpidvfqtgsgtssnmntneviasi
    aakggvtlhpnddvnmsqssndtfptathiaateaavahlipalqqlhdalaakaldwht
    vvksgrthlmdavpvtlgqefsgyarqieagiervraclprlgelaiggtavgtglnapd
    dfgvrvvavlvaqtglselrtaansfeaqaardglveasgalrtiavsltkiandirwmg
    sgpltglaeiqlpdlqpgssimpgkvnpvlpeavtqvaaqvigndaaiawggangafeln
    vyipmmarnilesfklltnvsrlfaqrciagltanvehlrrlaesspsivtplnsaigye
    eaaavakqalkerktirqtvidrgligdrlsiedldrrldvlamakaeqldsdrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3no9C (C:)
    sanyriehdtmgevrvpakalwraqtqravenfpisgrglertqiralgllkgacaqvns
    dlgllapekadaiiaaaaeiadgqhddqfpidvfqtgsgtssnmntneviasiaakggvt
    lhpnddvnmsqssndtfptathiaateaavahlipalqqlhdalaakaldwhtvvksgrt
    hlmdavpvtlgqefsgyarqieagiervraclprlgelaiggtavgtglnapddfgvrvv
    avlvaqtglselrtaansfeaqaardglveasgalrtiavsltkiandirwmgsgpltgl
    aeiqlpdlqpgkvnpvlpeavtqvaaqvigndaaiawggangafelnvyipmmarniles
    fklltnvsrlfaqrciagltanvehlrrlaesspsivtplnsaigyeeaaavakqalker
    ktirqtvidrgligdlsiedldrrldvlamaka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3no9D (D:)
    smavdadsanyriehdtmgevrvpakalwraqtqravenfpisgrglertqiralgllkg
    acaqvnsdlgllapekadaiiaaaaeiadgqhddqfpidvfqtgsgtssnmntneviasi
    aakggvtlhpnddvnmsqssndtfptathiaateaavahlipalqqlhdalaakaldwht
    vvksgrthlmdavpvtlgqefsgyarqieagiervraclprlgelaiggtavgtglnapd
    dfgvrvvavlvaqtglselrtaansfeaqaardglveasgalrtiavsltkiandirwmg
    sgpltglaeiqlpdlqpgssimpgkvnpvlpeavtqvaaqvigndaaiawggangafeln
    vyipmmarnilesfklltnvsrlfaqrciagltanvehlrrlaesspsivtplnsaigye
    eaaavakqalkerktirqtvidrgligdrlsiedldrrldvlamakaeqldsdrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3no9D (D:)
    anyriehdtmgevrvpakalwraqtqravenfpisgrglertqiralgllkgacaqvnsd
    lgllapekadaiiaaaaeiadgqhddqfpidvfqtgsgtssnmntneviasiaakggvtl
    hpnddvnmsqssndtfptathiaateaavahlipalqqlhdalaakaldwhtvvksgrth
    lmdavpvtlgqefsgyarqieagiervraclprlgelaiggtavgtglnapddfgvrvva
    vlvaqtglselrtaansfeaqaardglveasgalrtiavsltkiandirwmgsgpltgla
    eiqlpdlqpgkvnpvlpeavtqvaaqvigndaaiawggangafelnvyipmmarnilesf
    klltnvsrlfaqrciagltanvehlrrlaesspsivtplnsaigyeeaaavakqalkerk
    tirqtvidrgligdlsiedldrrldvlamaka