PDB entry 3no8

View 3no8 on RCSB PDB site
Description: Crystal structure of the PHR domain from human BTBD2 Protein
Deposited on 2010-06-24, released 2010-08-25
The last revision was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BTB/POZ domain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BTBD, BTBD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BX70 (Start-167)
      • conflict (125)
      • expression tag (168)
  • Chain 'B':
    Compound: BTB/POZ domain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BTBD, BTBD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BX70 (Start-167)
      • conflict (125)
      • expression tag (168)
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3no8A (A:)
    msldrprcclrgkecsinrfqqvesrwgysgtsdrirfsvnkrifvvgfglygsihgptd
    yqvniqiihtdsntvlgqndtgfscdgsastfrvmfkepvevlpnvnytacatlkgpdsh
    ygtkgmrkvthespttgaktcftfcyaagnnngtsvedgqipevifyteghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3no8A (A:)
    kecsinrfqqvesrwgysgtsdrirfsvnkrifvvgfglygsihgptdyqvniqiihtds
    ntvlgqndtgfscdgsastfrvmfkepvevlpnvnytacatlkgpdshygtkgmrkvthe
    spttgaktcftfcyaagnnngtsvedgqipevifyte
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3no8B (B:)
    msldrprcclrgkecsinrfqqvesrwgysgtsdrirfsvnkrifvvgfglygsihgptd
    yqvniqiihtdsntvlgqndtgfscdgsastfrvmfkepvevlpnvnytacatlkgpdsh
    ygtkgmrkvthespttgaktcftfcyaagnnngtsvedgqipevifyteghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3no8B (B:)
    kecsinrfqqvesrwgysgtsdrirfsvnkrifvvgfglygsihgptdyqvniqiihtds
    ntvlgqndtgfscdgsastfrvmfkepvevlpnvnytacatlkgpdshygtkgmrkvthe
    spttgaktcftfcyaagnnngtsvedgqipevifyte