PDB entry 3no6

View 3no6 on RCSB PDB site
Description: Crystal structure of a putative thiaminase II (SE1693) from Staphylococcus epidermidis ATCC 12228 at 1.65 A resolution
Class: hydrolase
Keywords: Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, PUTATIVE THIAMINASE-2, HYDROLASE
Deposited on 2010-06-24, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional activator tenA
    Species: Staphylococcus epidermidis [TaxId:176280]
    Gene: tenA, SE_1693
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CNK1 (19-End)
      • expression tag (11-18)
    Domains in SCOPe 2.07: d3no6a1, d3no6a2
  • Chain 'B':
    Compound: Transcriptional activator tenA
    Species: Staphylococcus epidermidis [TaxId:176280]
    Gene: tenA, SE_1693
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3no6b_
  • Chain 'C':
    Compound: Transcriptional activator tenA
    Species: Staphylococcus epidermidis [TaxId:176280]
    Gene: tenA, SE_1693
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3no6c_
  • Chain 'D':
    Compound: Transcriptional activator tenA
    Species: Staphylococcus epidermidis [TaxId:176280]
    Gene: tenA, SE_1693
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3no6d_
  • Heterogens: IMD, ACT, MPD, MRD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3no6A (A:)
    mgsdkihhhhhhenlyfqgmtfskelreasrpiiddiyndgfiqdllagklsnqavrqyl
    radasylkeftniyamlipkmssmedvkflveqiefmlegeveahevladfinepyeeiv
    kekvwppsgdhyikhmyfnafarenaaftiaamapcpyvyavigkramedpklnkesvts
    kwfqfystemdelvdvfdqlmdrltkhcsetekkeikenflqstiherhffnmayinekw
    eyggnnne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3no6A (A:)
    henlyfqgmtfskelreasrpiiddiyndgfiqdllagklsnqavrqylradasylkeft
    niyamlipkmssmedvkflveqiefmlegeveahevladfinepyeeivkekvwppsgdh
    yikhmyfnafarenaaftiaamapcpyvyavigkramedpklnkesvtskwfqfystemd
    elvdvfdqlmdrltkhcsetekkeikenflqstiherhffnmayinekweyggnn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3no6B (B:)
    mgsdkihhhhhhenlyfqgmtfskelreasrpiiddiyndgfiqdllagklsnqavrqyl
    radasylkeftniyamlipkmssmedvkflveqiefmlegeveahevladfinepyeeiv
    kekvwppsgdhyikhmyfnafarenaaftiaamapcpyvyavigkramedpklnkesvts
    kwfqfystemdelvdvfdqlmdrltkhcsetekkeikenflqstiherhffnmayinekw
    eyggnnne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3no6B (B:)
    mtfskelreasrpiiddiyndgfiqdllagklsnqavrqylradasylkeftniyamlip
    kmssmedvkflveqiefmlegeveahevladfinepyeeivkekvwppsgdhyikhmyfn
    afarenaaftiaamapcpyvyavigkramedpklnkesvtskwfqfystemdelvdvfdq
    lmdrltkhcsetekkeikenflqstiherhffnmayinekweyggn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3no6C (C:)
    mgsdkihhhhhhenlyfqgmtfskelreasrpiiddiyndgfiqdllagklsnqavrqyl
    radasylkeftniyamlipkmssmedvkflveqiefmlegeveahevladfinepyeeiv
    kekvwppsgdhyikhmyfnafarenaaftiaamapcpyvyavigkramedpklnkesvts
    kwfqfystemdelvdvfdqlmdrltkhcsetekkeikenflqstiherhffnmayinekw
    eyggnnne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3no6C (C:)
    mtfskelreasrpiiddiyndgfiqdllagklsnqavrqylradasylkeftniyamlip
    kmssmedvkflveqiefmlegeveahevladfinepyeeivkekvwppsgdhyikhmyfn
    afarenaaftiaamapcpyvyavigkramedpklnkesvtskwfqfystemdelvdvfdq
    lmdrltkhcsetekkeikenflqstiherhffnmayinekweyggn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3no6D (D:)
    mgsdkihhhhhhenlyfqgmtfskelreasrpiiddiyndgfiqdllagklsnqavrqyl
    radasylkeftniyamlipkmssmedvkflveqiefmlegeveahevladfinepyeeiv
    kekvwppsgdhyikhmyfnafarenaaftiaamapcpyvyavigkramedpklnkesvts
    kwfqfystemdelvdvfdqlmdrltkhcsetekkeikenflqstiherhffnmayinekw
    eyggnnne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3no6D (D:)
    mtfskelreasrpiiddiyndgfiqdllagklsnqavrqylradasylkeftniyamlip
    kmssmedvkflveqiefmlegeveahevladfinepyeeivkekvwppsgdhyikhmyfn
    afarenaaftiaamapcpyvyavigkramedpklnkesvtskwfqfystemdelvdvfdq
    lmdrltkhcsetekkeikenflqstiherhffnmayinekweyggnn