PDB entry 3no5

View 3no5 on RCSB PDB site
Description: crystal structure of a pfam duf849 domain containing protein (reut_a1631) from ralstonia eutropha jmp134 at 1.90 a resolution
Deposited on 2010-06-24, released 2010-08-25
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Ralstonia eutropha [TaxId:264198]
    Gene: Reut_A1631
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Ralstonia eutropha [TaxId:264198]
    Gene: Reut_A1631
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Ralstonia eutropha [TaxId:264198]
    Gene: Reut_A1631
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: Ralstonia eutropha [TaxId:264198]
    Gene: Reut_A1631
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Uncharacterized protein
    Species: Ralstonia eutropha [TaxId:264198]
    Gene: Reut_A1631
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q471D6 (1-274)
      • leader sequence (0)
  • Chain 'F':
    Compound: Uncharacterized protein
    Species: Ralstonia eutropha [TaxId:264198]
    Gene: Reut_A1631
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, EDO, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3no5A (A:)
    gmnkpciisvaitgslprkkdnpavpitvseqvestqaafeagatlvhlhvrnddetpts
    npdrfalvlegirkhapgmitqvstggrsgagnergamlslrpdmaslatgsvnfptrvy
    dnppelvdwlaaemktygikpeveafdlsmifqaaamqaagaivgplhiqfvmgiknamp
    vdrevlefyvqtlkrlspdatwtgagigrhqltmarwslelgghcrtglednvrldkntl
    apsnaalvrqvaelceeygrpvataaqareimslg
    

    Sequence, based on observed residues (ATOM records):
    >3no5A (A:)
    nkpciisvaitgslprkkdnpavpitvseqvestqaafeagatlvhlhvrnddetptsnp
    drfalvlegirkhapgmitqvstggrsgagnergamlslrpdmaslatgsvnfptrvydn
    ppelvdwlaaemktygikpeveafdlsmifqaaamqaagaivgplhiqfvmgiknampvd
    revlefyvqtlkrlspdatwtgagigrhqltmarwslelgghcrtglednvrldkntlap
    snaalvrqvaelceeygrpvataaqareimslg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3no5B (B:)
    gmnkpciisvaitgslprkkdnpavpitvseqvestqaafeagatlvhlhvrnddetpts
    npdrfalvlegirkhapgmitqvstggrsgagnergamlslrpdmaslatgsvnfptrvy
    dnppelvdwlaaemktygikpeveafdlsmifqaaamqaagaivgplhiqfvmgiknamp
    vdrevlefyvqtlkrlspdatwtgagigrhqltmarwslelgghcrtglednvrldkntl
    apsnaalvrqvaelceeygrpvataaqareimslg
    

    Sequence, based on observed residues (ATOM records):
    >3no5B (B:)
    nkpciisvaitgslprkkdnpavpitvseqvestqaafeagatlvhlhvrnddetptsnp
    drfalvlegirkhapgmitqvstggrsgagnergamlslrpdmaslatgsvnfptrvydn
    ppelvdwlaaemktygikpeveafdlsmifqaaamqaagaivgplhiqfvmgiknampvd
    revlefyvqtlkrlspdatwtgagigrhqltmarwslelgghcrtglednvrldkntlap
    snaalvrqvaelceeygrpvataaqareimsl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3no5C (C:)
    gmnkpciisvaitgslprkkdnpavpitvseqvestqaafeagatlvhlhvrnddetpts
    npdrfalvlegirkhapgmitqvstggrsgagnergamlslrpdmaslatgsvnfptrvy
    dnppelvdwlaaemktygikpeveafdlsmifqaaamqaagaivgplhiqfvmgiknamp
    vdrevlefyvqtlkrlspdatwtgagigrhqltmarwslelgghcrtglednvrldkntl
    apsnaalvrqvaelceeygrpvataaqareimslg
    

    Sequence, based on observed residues (ATOM records):
    >3no5C (C:)
    nkpciisvaitgslprkkdnpavpitvseqvestqaafeagatlvhlhvrnddetptsnp
    drfalvlegirkhapgmitqvstggrsgagnergamlslrpdmaslatgsvnfptrvydn
    ppelvdwlaaemktygikpeveafdlsmifqaaamqaagaivgplhiqfvmgiknampvd
    revlefyvqtlkrlspdatwtgagigrhqltmarwslelgghcrtglednvrldkntlap
    snaalvrqvaelceeygrpvataaqareimslg
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3no5D (D:)
    gmnkpciisvaitgslprkkdnpavpitvseqvestqaafeagatlvhlhvrnddetpts
    npdrfalvlegirkhapgmitqvstggrsgagnergamlslrpdmaslatgsvnfptrvy
    dnppelvdwlaaemktygikpeveafdlsmifqaaamqaagaivgplhiqfvmgiknamp
    vdrevlefyvqtlkrlspdatwtgagigrhqltmarwslelgghcrtglednvrldkntl
    apsnaalvrqvaelceeygrpvataaqareimslg
    

    Sequence, based on observed residues (ATOM records):
    >3no5D (D:)
    nkpciisvaitgslprkkdnpavpitvseqvestqaafeagatlvhlhvrnddetptsnp
    drfalvlegirkhapgmitqvstggrsgagnergamlslrpdmaslatgsvnfptrvydn
    ppelvdwlaaemktygikpeveafdlsmifqaaamqaagaivgplhiqfvmgiknampvd
    revlefyvqtlkrlspdatwtgagigrhqltmarwslelgghcrtglednvrldkntlap
    snaalvrqvaelceeygrpvataaqareimsl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >3no5E (E:)
    gmnkpciisvaitgslprkkdnpavpitvseqvestqaafeagatlvhlhvrnddetpts
    npdrfalvlegirkhapgmitqvstggrsgagnergamlslrpdmaslatgsvnfptrvy
    dnppelvdwlaaemktygikpeveafdlsmifqaaamqaagaivgplhiqfvmgiknamp
    vdrevlefyvqtlkrlspdatwtgagigrhqltmarwslelgghcrtglednvrldkntl
    apsnaalvrqvaelceeygrpvataaqareimslg
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3no5F (F:)
    gmnkpciisvaitgslprkkdnpavpitvseqvestqaafeagatlvhlhvrnddetpts
    npdrfalvlegirkhapgmitqvstggrsgagnergamlslrpdmaslatgsvnfptrvy
    dnppelvdwlaaemktygikpeveafdlsmifqaaamqaagaivgplhiqfvmgiknamp
    vdrevlefyvqtlkrlspdatwtgagigrhqltmarwslelgghcrtglednvrldkntl
    apsnaalvrqvaelceeygrpvataaqareimslg
    

    Sequence, based on observed residues (ATOM records):
    >3no5F (F:)
    nkpciisvaitgslprkkdnpavpitvseqvestqaafeagatlvhlhvrnddetptsnp
    drfalvlegirkhapgmitqvstggrsgagnergamlslrpdmaslatgsvnfptrvydn
    ppelvdwlaaemktygikpeveafdlsmifqaaamqaagaivgplhiqfvmgiknampvd
    revlefyvqtlkrlspdatwtgagigrhqltmarwslelgghcrtglednvrldkntlap
    snaalvrqvaelceeygrpvataaqareimslg