PDB entry 3no4

View 3no4 on RCSB PDB site
Description: crystal structure of a creatinine amidohydrolase (npun_f1913) from nostoc punctiforme pcc 73102 at 2.00 a resolution
Deposited on 2010-06-24, released 2010-08-25
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creatinine amidohydrolase
    Species: Nostoc punctiforme PCC 73102 [TaxId:63737]
    Gene: NPUN_22DEC03_CONTIG1_REVISED_GENENPF1913, Npun_F1913
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2J3U5 (19-266)
      • leader sequence (3-18)
  • Chain 'B':
    Compound: creatinine amidohydrolase
    Species: Nostoc punctiforme PCC 73102 [TaxId:63737]
    Gene: NPUN_22DEC03_CONTIG1_REVISED_GENENPF1913, Npun_F1913
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2J3U5 (19-266)
      • leader sequence (11-18)
  • Chain 'C':
    Compound: creatinine amidohydrolase
    Species: Nostoc punctiforme PCC 73102 [TaxId:63737]
    Gene: NPUN_22DEC03_CONTIG1_REVISED_GENENPF1913, Npun_F1913
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2J3U5 (19-266)
      • leader sequence (17-18)
  • Heterogens: NI, UNL, CL, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3no4A (A:)
    mgsdkihhhhhhenlyfqgmllhlstwqeveaylqqskgiifpigsteqhgptgligtda
    icaeaiaagvgdatgaivgptinvgmalhhtafpgtislrpstliqvvrdyvtclakagf
    skfyfinghggniatlkaafsetyahledlqianaqqvqcqvanwfmcgsvyklakelyg
    dqegshatpsevaltqyvypeaikqaplspevasghriysaadfrvrypdgrmgsnpgla
    tpehgkqfydlavkelsngylefvnad
    

    Sequence, based on observed residues (ATOM records):
    >3no4A (A:)
    dkihhhhhhenlyfqgmllhlstwqeveaylqqskgiifpigsteqhgptgligtdaica
    eaiaagvgdatgaivgptinvgmalhhtafpgtislrpstliqvvrdyvtclakagfskf
    yfinghggniatlkaafsetyahledlqianaqqvqcqvanwfmcgsvyklakelygdqe
    gshatpsevaltqyvypeaikqaplspevasghriysaadfrvrypdgrmgsnpglatpe
    hgkqfydlavkelsngylefvnad
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3no4B (B:)
    mgsdkihhhhhhenlyfqgmllhlstwqeveaylqqskgiifpigsteqhgptgligtda
    icaeaiaagvgdatgaivgptinvgmalhhtafpgtislrpstliqvvrdyvtclakagf
    skfyfinghggniatlkaafsetyahledlqianaqqvqcqvanwfmcgsvyklakelyg
    dqegshatpsevaltqyvypeaikqaplspevasghriysaadfrvrypdgrmgsnpgla
    tpehgkqfydlavkelsngylefvnad
    

    Sequence, based on observed residues (ATOM records):
    >3no4B (B:)
    henlyfqgmllhlstwqeveaylqqskgiifpigsteqhgptgligtdaicaeaiaagvg
    datgaivgptinvgmalhhtafpgtislrpstliqvvrdyvtclakagfskfyfinghgg
    niatlkaafsetyahledlqianaqqvqcqvanwfmcgsvyklakelygdqegshatpse
    valtqyvypeaikqaplspevasghriysaadfrvrypdgrmgsnpglatpehgkqfydl
    avkelsngylefvnad
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3no4C (C:)
    mgsdkihhhhhhenlyfqgmllhlstwqeveaylqqskgiifpigsteqhgptgligtda
    icaeaiaagvgdatgaivgptinvgmalhhtafpgtislrpstliqvvrdyvtclakagf
    skfyfinghggniatlkaafsetyahledlqianaqqvqcqvanwfmcgsvyklakelyg
    dqegshatpsevaltqyvypeaikqaplspevasghriysaadfrvrypdgrmgsnpgla
    tpehgkqfydlavkelsngylefvnad
    

    Sequence, based on observed residues (ATOM records):
    >3no4C (C:)
    qgmllhlstwqeveaylqqskgiifpigsteqhgptgligtdaicaeaiaagvgdatgai
    vgptinvgmalhhtafpgtislrpstliqvvrdyvtclakagfskfyfinghggniatlk
    aafsetyahledlqianaqqvqcqvanwfmcgsvyklakelygdqegshatpsevaltqy
    vypeaikqaplspevasghriysaadfrvrypdgrmgsnpglatpehgkqfydlavkels
    ngylefvnad